Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate WP_013011561.1 DACET_RS11565 ATP phosphoribosyltransferase
Query= reanno::WCS417:GFF870 (211 letters) >NCBI__GCF_000025725.1:WP_013011561.1 Length = 209 Score = 162 bits (409), Expect = 5e-45 Identities = 88/202 (43%), Positives = 135/202 (66%), Gaps = 3/202 (1%) Query: 2 LTIALSKGRILDDTLPLLAEAGIVPTENPD-KSRKLIIPTTQDDVRLLIVRATDVPTYVE 60 + +AL KGR+ +DT+ L + GI D SR+L +++++ ++VR DV TYVE Sbjct: 6 VNVALPKGRLAEDTIELFLKQGITNEGVVDFNSRRLTFYDEKNNIKFMMVRNMDVSTYVE 65 Query: 61 HGAADLGVAGKDVLMEYGGQGLYEPLDLRIALCKLMTAG-RVGDVEPKGRLRVATKFVNV 119 HGAAD+GV GKD+L+E G +YE LDL C+L AG R D+ + + VATK+ + Sbjct: 66 HGAADIGVVGKDILLE-SGSDVYEYLDLGFGFCRLCVAGIRNSDLSYRHDMVVATKYPML 124 Query: 120 AKRYYAEQGRQVDIIKLYGSMELAPLIGLADKIIDVVDTGNTLRANGLEPQEFIADISSR 179 K ++A +G V+ IKLYGS+EL+P++GL+D I+D+V TG TL+ NGL E I + ++R Sbjct: 125 TKNFFASKGVFVETIKLYGSIELSPIVGLSDFIVDLVSTGQTLKKNGLIEVETILESTAR 184 Query: 180 LIVNKASMKMQHARIQALIDTL 201 LI NK+ K+++ RI+ +I+T+ Sbjct: 185 LIGNKSMAKVKYDRIKEIIETV 206 Lambda K H 0.320 0.138 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 209 Length adjustment: 21 Effective length of query: 190 Effective length of database: 188 Effective search space: 35720 Effective search space used: 35720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate WP_013011561.1 DACET_RS11565 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.1580511.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-66 207.9 0.0 7.3e-66 207.6 0.0 1.1 1 NCBI__GCF_000025725.1:WP_013011561.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000025725.1:WP_013011561.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 207.6 0.0 7.3e-66 7.3e-66 2 182 .. 7 186 .. 6 187 .. 0.95 Alignments for each domain: == domain 1 score: 207.6 bits; conditional E-value: 7.3e-66 TIGR00070 2 riAlpKGrleeetlkllekaglk...lskkeerkliasaedeevevlllrakdiptyvekgaadlGitGkDll 71 ++AlpKGrl+e+t++l+ k g++ + + ++r+l++ +e+++++++++r++d+ tyve+gaad+G++GkD+l NCBI__GCF_000025725.1:WP_013011561.1 7 NVALPKGRLAEDTIELFLKQGITnegVVDFNSRRLTFYDEKNNIKFMMVRNMDVSTYVEHGAADIGVVGKDIL 79 89********************9444445559***************************************** PP TIGR00070 72 eEseadvvelldlgfgkcklvlAvpeesdvesledlkegkriATkypnltreylekkgvkveivkleGavEla 144 Es++dv+e ldlgfg c+l++A ++sd++ +d + +ATkyp lt++++++kgv ve +kl+G++El+ NCBI__GCF_000025725.1:WP_013011561.1 80 LESGSDVYEYLDLGFGFCRLCVAGIRNSDLSYRHD----MVVATKYPMLTKNFFASKGVFVETIKLYGSIELS 148 ****************************9999444....56******************************** PP TIGR00070 145 pllgladaIvDivetGttLrengLkiieeilessarli 182 p++gl+d+IvD+v+tG+tL++ngL ++e+iles+arli NCBI__GCF_000025725.1:WP_013011561.1 149 PIVGLSDFIVDLVSTGQTLKKNGLIEVETILESTARLI 186 *************************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (209 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 14.36 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory