Align Methionine synthase component, methyltransferase domain (EC:2.1.1.13) (characterized)
to candidate WP_013010175.1 DACET_RS04345 methionine synthase
Query= reanno::Phaeo:GFF1321 (338 letters) >NCBI__GCF_000025725.1:WP_013010175.1 Length = 1116 Score = 144 bits (363), Expect = 1e-38 Identities = 99/312 (31%), Positives = 160/312 (51%), Gaps = 31/312 (9%) Query: 15 LLADGATGTNLFNMGLQSGDAPELW----------NVDEPKKITALYQGAVDAGSDLFLT 64 +L DGA GT++ N + E+W NV P+ I +++ +AG+D+ T Sbjct: 11 ILFDGAMGTSIQNYEITD----EIWQGYNGCSEWLNVAAPEIIQQIHEQYFEAGADVVET 66 Query: 65 NTFGGTAARLKLHDAHRRVRELNVAGAELGRNVADRSERKIAVAGSVGPTGEIMQPVGEL 124 NTFGGT + +D R ELN+ GA++ R AD+ + AGS+GP G + +G++ Sbjct: 67 NTFGGTELVMSEYDLQDRTYELNLLGAQIARRAADKYGK--YTAGSIGP-GTKLPSLGQI 123 Query: 125 SHALAVEMFHEQAEALKEGGVDVLWLETISAPEEYRAA------AEAFKLADMPWCGTMS 178 S+ M+H QAEAL EGGVD+ +ET + ++A +A K +D P +++ Sbjct: 124 SYDDLYTMYHSQAEALLEGGVDLFIIETCQDLLQIKSALNAVIDVKAEKNSDAPVMVSIT 183 Query: 179 FDTAGRTMMGVTSADMAQLVEEFDPAPLAFGANCGTGASDILRTVLGFAAQGTTRPIISK 238 + G +MG + L+ E+ + G NC TG D++ + AQ I Sbjct: 184 VEQNGTMLMGTDISAAVTLLREY--PVFSLGLNCSTG-PDLMHNPINDLAQNFNGRISCI 240 Query: 239 GNAGIPKYVDGHIHYDGTPTLMGEYA-AMARDCGAKIIGGCCGTMPDHLRAMREALD--- 294 NAG+P+ G + YD TP M + M ++ ++GGCCGT P+H++A+R D Sbjct: 241 PNAGLPENRGGQMVYDMTPDKMAKIVEGMVQEFPIGVLGGCCGTTPEHIKALRPIADKYK 300 Query: 295 -TRPRGEQLTLE 305 +P+ ++ T E Sbjct: 301 PNKPQAKEYTGE 312 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 832 Number of extensions: 43 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 1116 Length adjustment: 37 Effective length of query: 301 Effective length of database: 1079 Effective search space: 324779 Effective search space used: 324779 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory