Align Methionine synthase component, pterin-binding domain (EC:2.1.1.13) (characterized)
to candidate WP_013010175.1 DACET_RS04345 methionine synthase
Query= reanno::Phaeo:GFF1582 (353 letters) >NCBI__GCF_000025725.1:WP_013010175.1 Length = 1116 Score = 108 bits (271), Expect = 5e-28 Identities = 86/284 (30%), Positives = 144/284 (50%), Gaps = 19/284 (6%) Query: 20 PFCVIGERINPTGRKKLAAELEAGDFSTVEKDALAQVMAGANILDINAGVVYNSNPNPNE 79 P +IGER N G K L A DF + A Q GA+ +D A V Y Sbjct: 327 PPALIGERANANGSKAFRELLLAEDFDGMLAVAKEQEETGAHFID--ACVAY-----AGR 379 Query: 80 TEPPLMTKIVELVQGLTDTPLCIDSSVPGALEAGLQAAEGRPLLNSVTGEE--ERLEHVL 137 E M K + L+ P+ IDS+ P +E L++ G+P++NS+ E+ E+L +L Sbjct: 380 DEKADMAKFMHLLNKTLTAPVVIDSTEPDVVETALKSCAGKPVINSINFEDGGEKLHIIL 439 Query: 138 PLVKKYNVPVVAISNDDTGISEDPDVRFAVAKKIVE-RAADFGIPAHDIVVDPLVMPIGA 196 VKK+ V+A++ D+ G++ + +F +A++I ++G+ +D++ DPL IG+ Sbjct: 440 RAVKKHPASVIALTIDEDGMAMTAEKKFEIAERIYNIFTKEYGLNPNDLIFDPLTFSIGS 499 Query: 197 ----MATAGQQVFALVRRLREEL-GVNTTCGASNVSFGL--PNRHGINNAFLPMAMGAGM 249 + A Q ++ ++E+L G T G SN+SFGL +R +N+ FL A+ G+ Sbjct: 500 GDKTLVDAAIQTNKAIKMIKEKLTGAKTALGLSNISFGLSKDSRPILNSVFLHEAVEHGL 559 Query: 250 TSAIMNPVALPITQKKIAEKKAEVEAAGIILPEGMEDEAFVQMF 293 AI++ + + Q I E+ +V + EG AF++ F Sbjct: 560 DMAIVH-ASKVMPQAAIPEEDIKVSKDLLAGQEGAL-SAFIEHF 601 Lambda K H 0.315 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 675 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 1116 Length adjustment: 37 Effective length of query: 316 Effective length of database: 1079 Effective search space: 340964 Effective search space used: 340964 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory