Align Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial; Beta-alanine-pyruvate aminotransferase 2; EC 2.6.1.44 (characterized)
to candidate WP_011187683.1 DP_RS02180 acetylornithine transaminase
Query= SwissProt::Q94AL9 (477 letters) >NCBI__GCF_000025945.1:WP_011187683.1 Length = 397 Score = 193 bits (490), Expect = 1e-53 Identities = 128/396 (32%), Positives = 193/396 (48%), Gaps = 28/396 (7%) Query: 78 RKPLNIVDGKMQYLFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKRLQHPTVLYL 137 R P+ +G L D +G++Y+D AGIAV + GHCHP +V + Q +RL H + LY Sbjct: 20 RYPVAFTEGTGCVLTDANGKKYVDFLAGIAVCSLGHCHPRIVNAIREQSERLIHVSNLYY 79 Query: 138 NHAIADFSEALASKLPGDLKVVFFTNSGTEANELALMMAKLYT--GCQDIVAVRNGYHGN 195 A +E L GD VFF NSG EANE A+ +A+++ G I+++ +HG Sbjct: 80 TEAQTRLAELLVENSFGDK--VFFCNSGAEANEAAIKLARIHAPAGKNKIISLTGAFHGR 137 Query: 196 AAATMGATGQSMWKFNVVQNSVHHALNPDPYRGVFGSDGEKYAKDLQDLIQYGTTGHIAG 255 T+ ATGQ+ +F + P+ + D ++ + Sbjct: 138 TMVTLAATGQA--RFCAGFEPIPTGFAAAPFADL-------------DALEAMIDDTVCA 182 Query: 256 FICEAIQGVGGIVELAPGYLSAAYDTVKKAGGLFIADEVQSGFARTGNFWGFEAHNVVPD 315 +CE +QG GG+ L YL D + G L I DEVQ+G R+G+ + + V PD Sbjct: 183 VLCEPLQGEGGVRPLGREYLQGIRDICDRHGVLLIFDEVQTGVGRSGSLFAHQVFGVEPD 242 Query: 316 IVTMAKGIGNGFPLGAVVTTPEIAGVLTRRSYFNTFGGNSVSTTAGLAVLNVIEKEKLQE 375 I+T+AKG+ +G P+GA++T +A L S+ +TFGGN V A L VI ++ Sbjct: 243 IMTLAKGLASGMPIGAIITRDAVAASLVPGSHGSTFGGNPVVCAAASTNLEVILEDGFLA 302 Query: 376 NAAMVGSYLKEKLTQL-KEKHEIIGDVRGRGLMLGVELVSDRKLKTPATAETLHIMDQMK 434 V +L + L +L KE I + RG GL+ G+ + + K I+ +M Sbjct: 303 EVKSVAEHLAQSLGKLVKEFPAIFTEERGLGLLRGLVMTEEGK------KSGSKIVMEML 356 Query: 435 ELGVLIGKGGYFGNVFRITPPLCFTKDDADFLVEAM 470 E G LI G G R PPL +++ D L A+ Sbjct: 357 EKGFLINFAG--GVALRFAPPLVVSREQCDSLAAAL 390 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 397 Length adjustment: 32 Effective length of query: 445 Effective length of database: 365 Effective search space: 162425 Effective search space used: 162425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory