Align Serine hydroxymethyltransferase; SHMT; Serine methylase; L-threonine/L-allo-threonine aldolase; EC 2.1.2.1; EC 4.1.2.48 (characterized)
to candidate WP_041277854.1 DP_RS09575 serine hydroxymethyltransferase
Query= SwissProt::D3DKC4 (427 letters) >NCBI__GCF_000025945.1:WP_041277854.1 Length = 416 Score = 453 bits (1165), Expect = e-132 Identities = 226/422 (53%), Positives = 304/422 (72%), Gaps = 6/422 (1%) Query: 1 MRHLFNTDAEIYEAIVKEYERQFYHLELIASENFTSLAVMEAQGSVMTNKYAEGLPHKRY 60 M L D EI+ I +E RQ + LIASEN+ S AV+EA GS++TNKY+EG P KRY Sbjct: 1 MTALQQQDPEIFSLIQQEEVRQHNKIRLIASENYVSSAVLEATGSILTNKYSEGYPGKRY 60 Query: 61 YGGCEFVDIAEDLAIERAKALFDAEHANVQPHSGTQANMAVYMAVLKPGDTIMGMDLSHG 120 Y G + +D E +AI+RAKA+F AEH NVQP+SG+ ANMAVY+A LKPGDTI+GM L HG Sbjct: 61 YEGQQLIDQIESIAIDRAKAVFGAEHVNVQPYSGSPANMAVYLAFLKPGDTILGMALPHG 120 Query: 121 GHLTHGAKVNFSGKIYNAVYYGVHPETHLIDYDQLYRLAKEHKPKLIVGGASAYPRVIDW 180 GHLTHG+KV+ SGK +NAV Y ++ E ++DY+++ A E KPK+++ G SAYPR++D+ Sbjct: 121 GHLTHGSKVSISGKYFNAVSYALNEEG-ILDYEEIRNKALECKPKILIAGHSAYPRILDF 179 Query: 181 AKLREIADSVGAYLMVDMAHYAGLIAGGVYPNPVPYAHFVTSTTHKTLRGPRSGFILCKK 240 AK REIAD VGA LMVDMAH+AGL+AGGV+P+P PYA VT+TTHK+LRGPR I+CK Sbjct: 180 AKFREIADEVGALLMVDMAHFAGLVAGGVHPSPFPYADVVTTTTHKSLRGPRGAMIMCKA 239 Query: 241 EFAKDIDKSVFPGIQGGPLMHVIAAKAVAFKEAMSQEFKEYARQVVANARVLAEEFIKEG 300 E+AK IDK+VFPG+QGGP AA AVA KEA + FK+Y QVV NA LA+ I++G Sbjct: 240 EYAKAIDKAVFPGMQGGPHDSTTAAIAVALKEASTDSFKKYTAQVVENAASLADVLIEKG 299 Query: 301 FKVVSGGTDSHIVLLDLRDTGLTGREVEEALGKANITVNKNAVPFDPLPPVKTSGIRLGT 360 F +V+GGT++H++L+DL + +TG++ +AL A I +N N+VPFD P SGIRLGT Sbjct: 300 FNLVTGGTENHLMLIDLSNKNITGKQAAKALDAAGIVLNCNSVPFDKRKPFDPSGIRLGT 359 Query: 361 PAMTTRGMKEDQMRIIARLISKVIKNIGDEKVIEYVRQEVIEMCEQFPLYPELREEINHL 420 A+T+RG + +M I+ ++ +V+ N D V+ + QEV +C++FP + H+ Sbjct: 360 CAITSRGFAKAEMVILGNMMDRVVNNFEDSAVLAEIAQEVQALCDKFP-----APGLEHI 414 Query: 421 AK 422 AK Sbjct: 415 AK 416 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 566 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 416 Length adjustment: 32 Effective length of query: 395 Effective length of database: 384 Effective search space: 151680 Effective search space used: 151680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory