Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate WP_011190179.1 DP_RS14870 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q56232 (385 letters) >NCBI__GCF_000025945.1:WP_011190179.1 Length = 395 Score = 168 bits (426), Expect = 2e-46 Identities = 115/357 (32%), Positives = 175/357 (49%), Gaps = 16/357 (4%) Query: 39 GEPDFDTPEHVKEAARRALAQ---GKTKYAPPAGIPELREALAEKFRRENGLSVTPEETI 95 G PD P + + A G Y P G +REA+A + +E G+ V + + Sbjct: 42 GNPDAPPPAQFDQVLAKIAADNGPGTHSYMPNGGHLWVREAVAGQMAKEQGVKVVASDML 101 Query: 96 VTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPE 155 ++ G + + +++L+PGDEVI L+PY+V Y V GG V+T +E F PD Sbjct: 102 LSCGAAGGINVIMKSLLNPGDEVIFLAPYFVEYDFYVDNHGGKSRVVQT--DENFNPDMA 159 Query: 156 RVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVE------HDFYLVSDEIYEHL 209 +R AI+ +TKA+++NSPNNPTG +Y KE+L L L E YL+SDE Y + Sbjct: 160 AIREAISEKTKAIIINSPNNPTGQIYSKEILAELGLLLTEMGEKFGSTIYLISDEPYRKI 219 Query: 210 LYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDT 269 Y+G A +++ V+ +K ++ G RIGY + + VS+ T + Sbjct: 220 TYDGIEVPSIFAAYSNSIIVSSYSKDLSLPGERIGYVAVHPGISEKAELVSAM--TLANR 277 Query: 270 IAQWATLEALTNQE-ASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTS 328 I + AL + A + + E Y RRR+ + LT G V P GAFY+ S Sbjct: 278 ILGFVNAPALMQRVIAELQGISVDNERYARRREAFCQILTEAGFDFVPPKGAFYI-FPKS 336 Query: 329 PIAPDEVRAAERLLEAGVAVVPGTDFAAFGHVRLSYATSEENLRKALERFARVLGRA 385 PI D+V L E + VPG F A G++RL++ +E + + F R +A Sbjct: 337 PI-EDDVAFCAILQEEKILAVPGRGFGAPGYIRLAFCVPDETIAGSAAAFKRAYQKA 392 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 395 Length adjustment: 31 Effective length of query: 354 Effective length of database: 364 Effective search space: 128856 Effective search space used: 128856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory