Align Ornithine aminotransferase, mitochondrial; Ornithine delta-aminotransferase; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_011187683.1 DP_RS02180 acetylornithine transaminase
Query= SwissProt::Q10G56 (473 letters) >NCBI__GCF_000025945.1:WP_011187683.1 Length = 397 Score = 248 bits (633), Expect = 3e-70 Identities = 138/406 (33%), Positives = 212/406 (52%), Gaps = 12/406 (2%) Query: 37 LTSEELMRMERERSAHNYHPIPVVFSKGEGSHILDPEGNKYIDFLSAYSAVNQGHCHPKV 96 +T+E + + NY PV F++G G + D G KY+DFL+ + + GHCHP++ Sbjct: 1 MTNESVKERADKVLVGNYGRYPVAFTEGTGCVLTDANGKKYVDFLAGIAVCSLGHCHPRI 60 Query: 97 LRALKEQAERLTLSSRAFYNDKFPIFAEYLTSMFGYEMMLPMNTGAEGVETAIKLVRKWG 156 + A++EQ+ERL S +Y + AE L + + N+GAE E AIKL R Sbjct: 61 VNAIREQSERLIHVSNLYYTEAQTRLAELLVENSFGDKVFFCNSGAEANEAAIKLAR--- 117 Query: 157 YEKKKIPKNEALIVSCCGCFHGRTLGVISMSCDNDATRGFGPLVPGHLKVDFGDTDGLEK 216 P + I+S G FHGRT+ ++ + GF P+ G F D D LE Sbjct: 118 ---IHAPAGKNKIISLTGAFHGRTMVTLAATGQARFCAGFEPIPTGFAAAPFADLDALEA 174 Query: 217 IFKDHGERICGFLFEPIQGEAGVIIPPDGYLKAVRDLCSRHNILMIADEIQTGIARTGKM 276 + D +C L EP+QGE GV YL+ +RD+C RH +L+I DE+QTG+ R+G + Sbjct: 175 MIDD---TVCAVLCEPLQGEGGVRPLGREYLQGIRDICDRHGVLLIFDEVQTGVGRSGSL 231 Query: 277 LACDWENIRPDVVILGKALGAGVVPVSAVLADKDIMLCIKPGEHGSTFGGNPLASAVAVA 336 A + PD++ L K L +G +P+ A++ + + PG HGSTFGGNP+ A A Sbjct: 232 FAHQVFGVEPDIMTLAKGLASG-MPIGAIITRDAVAASLVPGSHGSTFGGNPVVCAAAST 290 Query: 337 SLKVVTDEGLVERAAKLGQEFRDQLQKVQQRFPQIIREVRGRGLLNAVDLSNEALSPASA 396 +L+V+ ++G + + + L K+ + FP I E RG GLL + ++ E S Sbjct: 291 NLEVILEDGFLAEVKSVAEHLAQSLGKLVKEFPAIFTEERGLGLLRGLVMTEEGKKSGS- 349 Query: 397 YDICIKLKERGVLAKPTHDTIIRLAPPLSISPEELAEASKAFSDVL 442 I +++ E+G L +R APPL +S E+ + A +VL Sbjct: 350 -KIVMEMLEKGFLINFAGGVALRFAPPLVVSREQCDSLAAALREVL 394 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 473 Length of database: 397 Length adjustment: 32 Effective length of query: 441 Effective length of database: 365 Effective search space: 160965 Effective search space used: 160965 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory