Align acetylornithine transaminase (EC 2.6.1.11); 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate WP_011187683.1 DP_RS02180 acetylornithine transaminase
Query= BRENDA::B1XNF8 (418 letters) >NCBI__GCF_000025945.1:WP_011187683.1 Length = 397 Score = 351 bits (900), Expect = e-101 Identities = 182/398 (45%), Positives = 254/398 (63%), Gaps = 13/398 (3%) Query: 21 DQYVMHTYGRFPVAIAKGEGCRLWDTEGKSYLDFVAGIATCTLGHAHPALIQAVSAQIQK 80 D+ ++ YGR+PVA +G GC L D GK Y+DF+AGIA C+LGH HP ++ A+ Q ++ Sbjct: 11 DKVLVGNYGRYPVAFTEGTGCVLTDANGKKYVDFLAGIAVCSLGHCHPRIVNAIREQSER 70 Query: 81 LHHISNLYYIPEQGALAQWIVEHSCADKVFFCNSGAEANEAAIKLVRKYAHTVSDFLEQP 140 L H+SNLYY Q LA+ +VE+S DKVFFCNSGAEANEAAIKL R +A + Sbjct: 71 LIHVSNLYYTEAQTRLAELLVENSFGDKVFFCNSGAEANEAAIKLARIHAPAGKN----- 125 Query: 141 VILSAKSSFHGRTLATITATGQPKYQKHFDPLPDGFAYVPYNDIRALEEAITDIDEGNRR 200 I+S +FHGRT+ T+ ATGQ ++ F+P+P GFA P+ D+ ALE I D Sbjct: 126 KIISLTGAFHGRTMVTLAATGQARFCAGFEPIPTGFAAAPFADLDALEAMIDD------T 179 Query: 201 VAAIMLEALQGEGGVRPGDVEYFKAVRRICDENGILLVLDEVQVGVGRTGKYWGYENLGI 260 V A++ E LQGEGGVRP EY + +R ICD +G+LL+ DEVQ GVGR+G + ++ G+ Sbjct: 180 VCAVLCEPLQGEGGVRPLGREYLQGIRDICDRHGVLLIFDEVQTGVGRSGSLFAHQVFGV 239 Query: 261 EPDIFTSAKGLAGGIPIGAMMCKDSCAV-FNPGEHASTFGGNPFSCAAALAVVETLEQEN 319 EPDI T AKGLA G+PIGA++ +D+ A PG H STFGGNP CAAA +E + ++ Sbjct: 240 EPDIMTLAKGLASGMPIGAIITRDAVAASLVPGSHGSTFGGNPVVCAAASTNLEVILEDG 299 Query: 320 LLENVNARGEQLRAGLKTLAEKYP-YFSDVRGWGLINGMEIKADLELTSIEVVKAAMEKG 378 L V + E L L L +++P F++ RG GL+ G+ + + + + ++V +EKG Sbjct: 300 FLAEVKSVAEHLAQSLGKLVKEFPAIFTEERGLGLLRGLVMTEEGKKSGSKIVMEMLEKG 359 Query: 379 LLLAPAGPKVLRFVPPLIVSAAEINEAIALLDQTLAAM 416 L+ AG LRF PPL+VS + + A L + L+ + Sbjct: 360 FLINFAGGVALRFAPPLVVSREQCDSLAAALREVLSVL 397 Lambda K H 0.319 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 397 Length adjustment: 31 Effective length of query: 387 Effective length of database: 366 Effective search space: 141642 Effective search space used: 141642 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory