Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate WP_041278539.1 DP_RS08225 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >NCBI__GCF_000025945.1:WP_041278539.1 Length = 339 Score = 281 bits (718), Expect = 2e-80 Identities = 154/335 (45%), Positives = 211/335 (62%), Gaps = 3/335 (0%) Query: 6 QQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAATVMR 65 +QA+ R + ++ EM+ M ++M G+ S A +++ +T LR+K E + EI GA VMR Sbjct: 4 RQAIARVVTGADLSESEMMASMEEVMSGQASPAQIASFITALRMKGEAVEEIVGAVRVMR 63 Query: 66 EFSRRVE--VTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKSG 123 + + ++ + ++DIVGTGGDG+ TFN+ST FV AA G VAKHGNR+VSS+ G Sbjct: 64 DKATFIDCGLGPDDILMDIVGTGGDGADTFNVSTTTSFVVAAAGVAVAKHGNRAVSSRCG 123 Query: 124 SADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNILG 183 SAD LEALG + L P VA S+ + GIGF++AP+ H AMK RREMG+RTIFNILG Sbjct: 124 SADVLEALGVDLSLDPATVARSVQEIGIGFLFAPLLHAAMKHAIVPRREMGIRTIFNILG 183 Query: 184 PLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGELR 243 PLTNPAG+ L+GVF L + A VL LG R+LVVWG MDE+++ + + + Sbjct: 184 PLTNPAGANVQLIGVFERSLTTVLAEVLLRLGERRSLVVWGEGNMDEMTVTGTSYIADAH 243 Query: 244 DGQVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQ-VLDNVPGPALDIVALNAGAAL 302 DG+V Y V PED G+A +A ++ E A ++ VL G LD+V LNAGAAL Sbjct: 244 DGRVTSYAVEPEDVGLARAAVADISGGRTPEESAQQVRAVLAGEKGARLDMVLLNAGAAL 303 Query: 303 YVAGVADSIADGIVRARQVLADGSARACLDAYVAF 337 AG ++I +G+V AR V+ G+A L VAF Sbjct: 304 LAAGRVETIVEGVVMARDVVESGAALKKLGQLVAF 338 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 339 Length adjustment: 29 Effective length of query: 316 Effective length of database: 310 Effective search space: 97960 Effective search space used: 97960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_041278539.1 DP_RS08225 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.1274973.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-123 397.0 4.8 4.1e-123 396.8 4.8 1.0 1 NCBI__GCF_000025945.1:WP_041278539.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000025945.1:WP_041278539.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 396.8 4.8 4.1e-123 4.1e-123 2 329 .. 8 337 .. 7 338 .. 0.98 Alignments for each domain: == domain 1 score: 396.8 bits; conditional E-value: 4.1e-123 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkveke..eseelv 72 +++++ dLse e+++ m+e+msg+as+aqia++++alr+kge +eei+g+++++r+ka+ ++ +++ l+ NCBI__GCF_000025945.1:WP_041278539.1 8 ARVVTGADLSESEMMASMEEVMSGQASPAQIASFITALRMKGEAVEEIVGAVRVMRDKATFIDCGlgPDDILM 80 688999******************************************************99887668999** PP TIGR01245 73 DivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigF 145 DivGTGGDg++t+N+ST++++v+aaaGv vaKhGnr+vss++GsaDvLealgv l l+p+ vars++e gigF NCBI__GCF_000025945.1:WP_041278539.1 81 DIVGTGGDGADTFNVSTTTSFVVAAAGVAVAKHGNRAVSSRCGSADVLEALGVDLSLDPATVARSVQEIGIGF 153 ************************************************************************* PP TIGR01245 146 lfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhged 218 lfAP h a+k+++ R+e+g+rt+fN+LGPL+nPa a++q++Gv++++l++vlaevl +lg +r lvv ge+ NCBI__GCF_000025945.1:WP_041278539.1 154 LFAPLLHAAMKHAIVPRREMGIRTIFNILGPLTNPAGANVQLIGVFERSLTTVLAEVLLRLGERRSLVVWGEG 226 ************************************************************************* PP TIGR01245 219 glDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsa.eenaellkevlegkekkakrdivvlN 290 ++DE+++tg++++a+ +dg++++y ++ped gl+ra + ++ gg + ee+a+++++vl g++ +a+ d+v+lN NCBI__GCF_000025945.1:WP_041278539.1 227 NMDEMTVTGTSYIADAHDGRVTSYAVEPEDVGLARAAVADISGGRTpEESAQQVRAVLAGEK-GARLDMVLLN 298 ******************************************986559**********9998.999******* PP TIGR01245 291 aaaalyvagkakdlkegvelakeaiksgkalekleelva 329 a+aal++ag+++++ egv +a+++++sg+al+kl +lva NCBI__GCF_000025945.1:WP_041278539.1 299 AGAALLAAGRVETIVEGVVMARDVVESGAALKKLGQLVA 337 **********************************99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 14.09 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory