Align 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 (characterized)
to candidate WP_011764775.1 AZO_RS05285 3-isopropylmalate dehydrogenase
Query= SwissProt::Q56268 (358 letters) >NCBI__GCF_000061505.1:WP_011764775.1 Length = 354 Score = 427 bits (1098), Expect = e-124 Identities = 225/357 (63%), Positives = 276/357 (77%), Gaps = 9/357 (2%) Query: 3 KIAIFAGDGIGPEIVAAARQVLDAVDQAAHLGLRCTEGLVGGAALDASDDPLPAASLQLA 62 KI + GDGIGPEI A A +VL A+D L + E L+GG+A+DA+ P P A+ +LA Sbjct: 2 KICVLPGDGIGPEITAEAVRVLRALD----LKIELEEALLGGSAVDATGTPYPEATQKLA 57 Query: 63 MAADAVILGAVGGPRWDAYPPAKRPEQGLLRLRKGLDLYANLRPAQIFPQLLDASPLRPE 122 AADAV+LGAVGGP+WD P +RPE+GLL +RK L L+ANLRPA ++P+L +AS L+PE Sbjct: 58 RAADAVLLGAVGGPKWDTLPREQRPERGLLGIRKDLSLFANLRPAILYPELANASTLKPE 117 Query: 123 LVRDVDILVVRELTGDIYFGQPRGLEV--IDG--KRRGFNTMVYDEDEIRRIAHVAFRAA 178 +V +DIL+VRELTGDIYFGQPRG+E ++G +R G+NTM+Y E EIRRI VAF AA Sbjct: 118 VVSGLDILIVRELTGDIYFGQPRGIETREVNGAQQRVGWNTMIYAEYEIRRILKVAFEAA 177 Query: 179 QGRRKQLCSVDKANVLETTRLWREVVTEVARDYPDVRLSHMYVDNAAMQLIRAPAQFDVL 238 Q R K+LCSVDK NVLETT+LWR++ E+A+D+PDV LSHM VDNAAMQL+R P QFDV+ Sbjct: 178 QKRGKKLCSVDKMNVLETTQLWRDIADEMAKDFPDVELSHMLVDNAAMQLVRNPKQFDVM 237 Query: 239 LTGNMFGDILSDEASQLTGSIGMLPSASL-GEGRAMYEPIHGSAPDIAGQDKANPLATIL 297 +TGNMFGDILSDEAS LTGSIGMLPSASL + +YEP HGSAPDIAG+ ANPLATIL Sbjct: 238 VTGNMFGDILSDEASMLTGSIGMLPSASLDANNKGLYEPSHGSAPDIAGKGVANPLATIL 297 Query: 298 SVAMMLRHSLNAEPWAQRVEAAVQRVLDQGLRTADIAAPGTPVIGTKAMGAAVVNAL 354 S AMMLR++ N E A R+E AV++VL QG RT DI GT +GT+ MG AV+ AL Sbjct: 298 SAAMMLRYTFNQEEAAVRIERAVKKVLAQGFRTGDIYEAGTKKVGTREMGDAVLAAL 354 Lambda K H 0.320 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 354 Length adjustment: 29 Effective length of query: 329 Effective length of database: 325 Effective search space: 106925 Effective search space used: 106925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011764775.1 AZO_RS05285 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.2481481.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-159 516.5 0.0 1.8e-159 516.3 0.0 1.0 1 NCBI__GCF_000061505.1:WP_011764775.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000061505.1:WP_011764775.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 516.3 0.0 1.8e-159 1.8e-159 1 348 [. 2 349 .. 2 350 .. 0.97 Alignments for each domain: == domain 1 score: 516.3 bits; conditional E-value: 1.8e-159 TIGR00169 1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlgavGG 73 ki vLpGDgiGpe++aea++vL a+ +lk+e eeal+GG a+datg+P pe+t k +++adavLlgavGG NCBI__GCF_000061505.1:WP_011764775.1 2 KICVLPGDGIGPEITAEAVRVLRAL----DLKIELEEALLGGSAVDATGTPYPEATQKLARAADAVLLGAVGG 70 79********************997....58999*************************************** PP TIGR00169 74 pkWdnlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiYfGepkere 146 pkWd+lpr++rPe+gLL +rk+l lfanLrPa l+++L ++s+lk+e+v+g+D+++vreLtg iYfG+p+++e NCBI__GCF_000061505.1:WP_011764775.1 71 PKWDTLPREQRPERGLLGIRKDLSLFANLRPAILYPELANASTLKPEVVSGLDILIVRELTGDIYFGQPRGIE 143 **********************************************************************987 PP TIGR00169 147 eaee....ekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeiakeyPdvele 215 e ++ +++t+ Y ++ei+ri +vafe+a+kr kk++svDk nvLe+++lWr++++e+ak++Pdvel+ NCBI__GCF_000061505.1:WP_011764775.1 144 TREVngaqQRVGWNTMIYAEYEIRRILKVAFEAAQKRGKKLCSVDKMNVLETTQLWRDIADEMAKDFPDVELS 216 65432224889************************************************************** PP TIGR00169 216 hlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslsskglalfepvhgsapdiagkgi 288 h+++DnaamqLv++P+q+dv+vt+n+fGDilsDeas++tGs+G+LPsasl + ++l+ep hgsapdiagkg+ NCBI__GCF_000061505.1:WP_011764775.1 217 HMLVDNAAMQLVRNPKQFDVMVTGNMFGDILSDEASMLTGSIGMLPSASLDANNKGLYEPSHGSAPDIAGKGV 289 ************************************************************************* PP TIGR00169 289 anpiaailsaalllryslnleeaaeaieaavkkvleegkrtedlaseattavstkeveee 348 anp+a+ilsaa++lry++n+eeaa +ie+avkkvl++g rt d+++ +t++v+t+e+++ NCBI__GCF_000061505.1:WP_011764775.1 290 ANPLATILSAAMMLRYTFNQEEAAVRIERAVKKVLAQGFRTGDIYEAGTKKVGTREMGDA 349 *********************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 23.17 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory