Align [LysW]-L-2-aminoadipate 6-kinase monomer (EC 2.7.2.17) (characterized)
to candidate WP_011766967.1 AZO_RS16300 acetylglutamate kinase
Query= metacyc::MONOMER-6801 (269 letters) >NCBI__GCF_000061505.1:WP_011766967.1 Length = 300 Score = 115 bits (289), Expect = 8e-31 Identities = 81/274 (29%), Positives = 137/274 (50%), Gaps = 15/274 (5%) Query: 2 IVVKVGGAEGIN---YEAVAKDAASLWKEGVKLLLVHGGSAETNKVAEALGHPPRFLTHP 58 IV+K GG + + A+D L G+ ++VHGG + + +G F+ Sbjct: 34 IVIKYGGNAMTDPHLKDCFARDVVLLKLVGLNPVVVHGGGPQIETLLAKVGKKGEFV--- 90 Query: 59 GGQVSRLTDRKTLEIFEMVYCGLVNKRLVELLQKEGANAIGLSGLDGRLFVGRRKTAVKY 118 Q R+TD +T+E+ EMV G VNK +V L+ + G A+GL+G D F+ +K ++ Sbjct: 91 --QGMRVTDAETMEVVEMVLGGQVNKEIVNLINQAGGKAVGLTGKDAS-FIRAKKLLMQK 147 Query: 119 VENGKVKVHRGDYTGTVEEVNKALLDLLLQAGYLPVLTPPALSYENEAINTDGDQIAALL 178 ++ V G + ++ +L+ L Q ++PV+ P + E N + D +A L Sbjct: 148 LDAPAGDVIDVGQVGEITTIDPSLISFLDQGDFIPVIAPIGVGDNGETYNINADVVAGKL 207 Query: 179 ATLYGAEALVYLSNVPGLLARYPDEASLVREIPVERIEDPEYLALAQGRMKRKVMGAVEA 238 A + AE LV L+N PG+L + +L+ + +I+D G M K+ A++A Sbjct: 208 AEILKAEKLVLLTNTPGVLDK---AGNLLTGLTPRQIDDLVADGTLSGGMLPKIGSALDA 264 Query: 239 VKGGVKRVVFADGRVENPIRRAL---SGEGTVVR 269 + GVK V DGRVE+ + + G GT+++ Sbjct: 265 ARNGVKSVHIIDGRVEHCLLLEILTDHGVGTMIK 298 Lambda K H 0.317 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 300 Length adjustment: 26 Effective length of query: 243 Effective length of database: 274 Effective search space: 66582 Effective search space used: 66582 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory