Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_011766967.1 AZO_RS16300 acetylglutamate kinase
Query= BRENDA::Q87EL2 (421 letters) >NCBI__GCF_000061505.1:WP_011766967.1 Length = 300 Score = 110 bits (275), Expect = 6e-29 Identities = 88/286 (30%), Positives = 138/286 (48%), Gaps = 28/286 (9%) Query: 6 EISQYLKRFSQLDAKRFAVVKVGGAVLRDD--VDALTSSLSFLQEVGLTPIVLHGAGPQL 63 E Y+KRF + V+K GG + D D + L+ VGL P+V+HG GPQ+ Sbjct: 21 EALPYIKRFFD----KTIVIKYGGNAMTDPHLKDCFARDVVLLKLVGLNPVVVHGGGPQI 76 Query: 64 DEELTAVGIQKKTVNGFRVTLPETMAIVRKVFHA-TNLQLIEALQRNGARATSITGG--- 119 + L VG + + V G RVT ETM +V V N +++ + + G +A +TG Sbjct: 77 ETLLAKVGKKGEFVQGMRVTDAETMEVVEMVLGGQVNKEIVNLINQAGGKAVGLTGKDAS 136 Query: 120 ----------VFEAHYLDQETYGLVGGISAVNIAPIEASLRAASIPVIASLGETPSGQIL 169 +A D G VG I+ ++ + I + IPVIA +G +G+ Sbjct: 137 FIRAKKLLMQKLDAPAGDVIDVGQVGEITTIDPSLISFLDQGDFIPVIAPIGVGDNGETY 196 Query: 170 NINADVAANELVHVLQPYKIIFLTGTGGLLDADGKIINSINLSTEYEQLIQQPWVYGGMK 229 NINADV A +L +L+ K++ LT T G+LD G ++ + + + L+ + GGM Sbjct: 197 NINADVVAGKLAEILKAEKLVLLTNTPGVLDKAGNLLTGLT-PRQIDDLVADGTLSGGM- 254 Query: 230 LKIEQIKHLLD--RLPLESSVSITRPAD--LAKELFTHKGSGTLIR 271 + +I LD R ++S I + L E+ T G GT+I+ Sbjct: 255 --LPKIGSALDAARNGVKSVHIIDGRVEHCLLLEILTDHGVGTMIK 298 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 300 Length adjustment: 29 Effective length of query: 392 Effective length of database: 271 Effective search space: 106232 Effective search space used: 106232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory