Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_011763870.1 AZO_RS00670 branched-chain amino acid transaminase
Query= BRENDA::O86428 (307 letters) >NCBI__GCF_000061505.1:WP_011763870.1 Length = 306 Score = 377 bits (969), Expect = e-109 Identities = 173/302 (57%), Positives = 230/302 (76%) Query: 1 MSMADRDGVIWYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYDTPQGTAIFRLQAHTD 60 MSM DRDG IW DG+ + WRDA H LTHTLHYG+G FEG+RAY T G A+FRL H + Sbjct: 1 MSMEDRDGWIWMDGQWLPWRDAKVHALTHTLHYGLGCFEGIRAYPTAHGPAVFRLDDHIE 60 Query: 61 RLFDSAHIMNMQIPYSRDEINEATRAAVRENNLESAYIRPMVFYGSEGMGLRASGLKVHV 120 RLFDSAHI+ + +P + E+ A AVR N L+ YIRP+VF G+E +G+ +G HV Sbjct: 61 RLFDSAHILGLAMPCTPAEVRAACLEAVRRNGLDGGYIRPLVFLGAEKVGVDPAGAATHV 120 Query: 121 IIAAWSWGAYMGEEALQQGIKVRTSSFTRHHVNISMTRAKSNGAYINSMLALQEAISGGA 180 ++AAW WGAY+G +AL++GI+V+ +SF RHHVN+ M RAKS Y NS+LA +EA + G Sbjct: 121 MVAAWQWGAYLGAQALERGIRVKVASFARHHVNVQMCRAKSVSTYTNSILACREARAEGY 180 Query: 181 DEAMMLDPEGYVAEGSGENIFIIKDGVIYTPEVTACLNGITRNTILTLAAEHGFKLVEKR 240 DEA++LD +G+VAEG GEN+F++K GVIY PE+T+ L+GITR T+ TLA+E G+++ +R Sbjct: 181 DEALLLDTDGFVAEGPGENVFVVKRGVIYEPEITSALDGITRRTLQTLASEAGYEIRARR 240 Query: 241 ITRDEVYIADEAFFTGTAAEVTPIREVDGRKIGAGRRGPVTEKLQKAYFDLVSGKTEAHA 300 ITRDE+YIADE FFTGTAAE+TP+ EVD R++G+GR GPVT+ LQ+ +F V G+ AHA Sbjct: 241 ITRDELYIADEVFFTGTAAEITPVVEVDRRRVGSGRPGPVTQALQRRFFACVRGEDPAHA 300 Query: 301 EW 302 +W Sbjct: 301 DW 302 Lambda K H 0.319 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 306 Length adjustment: 27 Effective length of query: 280 Effective length of database: 279 Effective search space: 78120 Effective search space used: 78120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_011763870.1 AZO_RS00670 (branched-chain amino acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.1811946.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-127 409.0 0.0 6.2e-127 408.8 0.0 1.0 1 NCBI__GCF_000061505.1:WP_011763870.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000061505.1:WP_011763870.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 408.8 0.0 6.2e-127 6.2e-127 1 296 [. 11 304 .. 11 306 .] 0.99 Alignments for each domain: == domain 1 score: 408.8 bits; conditional E-value: 6.2e-127 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskeelvev 73 w+dG+ ++++dakvh lth+lhYG g feGiRaY t +g+a+frl++h+eRl+dsa+il l +p + e+ + NCBI__GCF_000061505.1:WP_011763870.1 11 WMDGQWLPWRDAKVHALTHTLHYGLGCFEGIRAYPTAHGPAVFRLDDHIERLFDSAHILGLAMPCTPAEVRAA 83 9************************************************************************ PP TIGR01122 74 tkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssfrraavnsi 146 + e++r+n+l+ YiRplv++Gae++g++p +++ ++v++aaw+wgaylg++ale+Gi+vkv+sf+r++vn+ NCBI__GCF_000061505.1:WP_011763870.1 84 CLEAVRRNGLDGGYIRPLVFLGAEKVGVDP-AGAATHVMVAAWQWGAYLGAQALERGIRVKVASFARHHVNVQ 155 ******************************.999*************************************** PP TIGR01122 147 ptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvsesiLkgitrdavik 219 + +ak++++Y ns+la ea+++Gydea+lLd++G+vaeG+Gen+f+vk gv++ P++ +s+L+gitr ++ + NCBI__GCF_000061505.1:WP_011763870.1 156 MCRAKSVSTYTNSILACREARAEGYDEALLLDTDGFVAEGPGENVFVVKRGVIYEPEI-TSALDGITRRTLQT 227 *********************************************************9.78************ PP TIGR01122 220 lakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkklqeaffdlvegktekke 292 la+e g+e++ +ri+r+ely+aDevf+tGtaae+tP++evD r++g+g+ Gpvt+ lq +ff v+g++++++ NCBI__GCF_000061505.1:WP_011763870.1 228 LASEAGYEIRARRITRDELYIADEVFFTGTAAEITPVVEVDRRRVGSGRPGPVTQALQRRFFACVRGEDPAHA 300 ************************************************************************* PP TIGR01122 293 ewlt 296 +wl NCBI__GCF_000061505.1:WP_011763870.1 301 DWLA 304 **96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (306 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 14.33 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory