Align Aminotransferase class V domain-containing protein (characterized, see rationale)
to candidate WP_013134047.1 ARNIT_RS01155 alanine--glyoxylate aminotransferase family protein
Query= uniprot:Q2FXK2 (386 letters) >NCBI__GCF_000092245.1:WP_013134047.1 Length = 370 Score = 199 bits (505), Expect = 1e-55 Identities = 121/359 (33%), Positives = 194/359 (54%), Gaps = 13/359 (3%) Query: 7 LLLTPGPTPVPDAIMREIQAPMVGHRSKDFEDIAQQAFQGLKPIFGSQNDVLILTSSGTS 66 +LLTPGPTPVP+ + + + + HR+ +FE I Q + L ++G ++V++L SSGT Sbjct: 1 MLLTPGPTPVPEFVRKAMADITIHHRTPEFESIFGQTRELLLELYG-MDEVVMLASSGTG 59 Query: 67 VLEASMLNIVNPEDHFVVIVSGAFGNRFKQIAQTYYKNVHIYDVTWGEAVDVKDFINFLS 126 +EA +LN+VN + + I SG FG RF +I + Y W V V++ ++ L Sbjct: 60 AMEACILNLVNKKA--LTINSGKFGERFGKICKAYNLPYTEIKNEWNTPVSVEEVMDTLK 117 Query: 127 TLNVEVKAVFSQYCETSTTVLHPIHELGNAINQFNSNIYFVVDGVSCIGAVDVDINKDKI 186 + E+ A+F Q CE++ + HP+ EL + +FN NI V DG++ +G +D + Sbjct: 118 N-DSEIDAIFIQICESAGGLRHPVEELAKQVKEFNKNIMIVADGITAVGVEKIDTT--NL 174 Query: 187 DVLVSGSQKAIMLPPGLAFVAYSHRAKEHFKEVTTPKFYLDLNKYISSQADNSTPFTPNV 246 D +++GSQKA+MLPPGLA + S+ A E + + +Y +L I Q N+T +T Sbjct: 175 DAVITGSQKALMLPPGLAMIGLSNVAVEKI-QTLSKGYYFNLATEIKVQKTNTTAWTAAT 233 Query: 247 SLFRGVNAYVETVKAEGFNHVIARHYAIR-NALRSALKALDLTLLVNDKDASPTVTAFKP 305 +L G+ + +K G + A+R A R ALKA+ + A+ T + Sbjct: 234 TLIIGLKEILTHIKNNGGFETLYEKTALRAKATREALKAIGCEIYPK-MPANAMTTIYTE 292 Query: 306 NTNDEVKIIKDELKNRFKITIAGGQGHLKGQILRIGHMGKISPFDILSVVSALEIILTE 364 N I+ LK ++ + IAGGQ H+K I RI HMG + F+ V+A+E+ + E Sbjct: 293 N----APAIRKILKTKYNVNIAGGQDHIKNSIFRINHMGLVEDFETAWAVNAVELAMDE 347 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 15 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 370 Length adjustment: 30 Effective length of query: 356 Effective length of database: 340 Effective search space: 121040 Effective search space used: 121040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory