Align cystathionine gamma-lyase (EC 4.4.1.1); cysteine-S-conjugate beta-lyase (EC 4.4.1.13) (characterized)
to candidate WP_013092629.1 BC1002_RS24185 cystathionine gamma-synthase family protein
Query= BRENDA::A2RM21 (380 letters) >NCBI__GCF_000092885.1:WP_013092629.1 Length = 413 Score = 207 bits (526), Expect = 6e-58 Identities = 135/404 (33%), Positives = 207/404 (51%), Gaps = 32/404 (7%) Query: 6 TKVIHGGISTDKTTGAVSVPIYQTSTYKQN------GLGQPKE---YEYSRSGNPTRHAL 56 T ++HG + GA+ P++ + Y G+ Q + + Y+R G PT AL Sbjct: 8 TGIVHGDRTAGTEHGALRQPVHTSVQYGFERVEDLIGVFQGTKKGGFNYARQGTPTTAAL 67 Query: 57 EELIADLEGGVQGFAFSSGLAGIHAV-LSLFSAGDHIILADDVYGGTFRLMDKVLTKTGI 115 E I LE GV FS+G+AGI A L+L AGDH++ + V+G T L L G+ Sbjct: 68 ERKITSLEEGVGTVCFSTGMAGITATFLTLLRAGDHLVSSRYVFGNTNSLFG-TLRALGV 126 Query: 116 IYDLVDLSNLDDLKAAFKEETKAIYFETPSNPLLKVLDIKEISAIAKAHDALTLVDNTFA 175 VD LDD+K A + T+ ++ ET +NP ++ D++ I + + +VDNT Sbjct: 127 EVTTVDACRLDDVKNAIRPNTRMVFVETIANPGTQIPDLQGIGDVCRERGIAYVVDNTIT 186 Query: 176 TPYLQQPIALGADIVLHSATKYLGGHSDVVAGLVTTNS---------------KELASEI 220 +P L +P A+GA +V++S TK + GH + G VT + A + Sbjct: 187 SPALFKPKAVGASLVINSLTKTIAGHGAALGGAVTDTGLFDWSAYPNIADDYRRSGAKDQ 246 Query: 221 GFLQ------NSIGAVLGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVY 274 G LQ +GA L + + + G +TLALR+ S NA +A+FLE +A+ KV+ Sbjct: 247 GLLQIRKKGLRDMGASLSSEQAHSIAMGAETLALRVRQSSDNALALAQFLEGHEAIGKVF 306 Query: 275 YPGLNSHPGHEIAKKQMSAFGGMISFELTDENAVKDFVENLSYFTLAESLGGVESLIEVP 334 YPGL SHP ++IA+ ++SFEL + + + + V L A LG +LI Sbjct: 307 YPGLKSHPQYDIAQTLFKGASWLLSFELLNVDRMIEVVNALKLPVKATGLGDTRTLIIPV 366 Query: 335 AVMTHASIPKELREEIGIKDGLIRLSVGVEAIEDLLTDIKEALE 378 A E R+ +GI DG++RLS G+E I+DL+ D +AL+ Sbjct: 367 APTIFFEAGPETRKAMGISDGMLRLSAGIEDIDDLIADFAQALK 410 Lambda K H 0.315 0.133 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 413 Length adjustment: 31 Effective length of query: 349 Effective length of database: 382 Effective search space: 133318 Effective search space used: 133318 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory