Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_013074746.1 BTUS_RS03510 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= curated2:B0TY45 (361 letters) >NCBI__GCF_000092905.1:WP_013074746.1 Length = 408 Score = 68.9 bits (167), Expect = 2e-16 Identities = 53/171 (30%), Positives = 82/171 (47%), Gaps = 6/171 (3%) Query: 60 RKLVEKLAKIYDVDASNILVTRGSDEGIDLLFRLYCEYQKDSAFAVEPTFGMYKIAAQLQ 119 R L ++ Y+ D + +LVT G+ EGID R D EP++ Y QL Sbjct: 79 RYLEDRFRVSYNPD-TEVLVTVGASEGIDAALRAILS-PGDEVLIPEPSYVSYGPCVQLA 136 Query: 120 GVDYKTLKLKEENNFEINITELLANIPDNCKLLFLCTPNNPTGKSIPLADIEQILS-ELA 178 G + + E+ F++ + + I K L L PNNPTG ++ D+EQI + L Sbjct: 137 GGAPVYVPTRAEDQFKLKASTIERFITPRTKALLLGYPNNPTGATLGEKDLEQIRAIVLK 196 Query: 179 GNCVVVVDEAYIEFS---NEKSVSSIINKYENLVVLRTLSKSFGMAGLRLG 226 + +V+ DE Y E S S S+ E ++L +SK++ M G R+G Sbjct: 197 HDLLVISDEIYAELSYVLPHTSFPSLPGMRERTMLLTGMSKAYAMTGWRVG 247 Lambda K H 0.317 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 408 Length adjustment: 30 Effective length of query: 331 Effective length of database: 378 Effective search space: 125118 Effective search space used: 125118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory