Align Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 (characterized)
to candidate WP_013074433.1 BTUS_RS01870 4-aminobutyrate--2-oxoglutarate transaminase
Query= SwissProt::P18335 (406 letters) >NCBI__GCF_000092905.1:WP_013074433.1 Length = 453 Score = 212 bits (540), Expect = 2e-59 Identities = 129/412 (31%), Positives = 203/412 (49%), Gaps = 41/412 (9%) Query: 30 KGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETLWHIS-NVFTNEPALR 88 + +G+ + D G ++DFAG I GH PA+V AL Q + H S +V E + Sbjct: 42 RAEGALVTDVDGNTFLDFAGAIGTMNAGHRPPAVVKALHEQVDRFLHTSFHVAMYESYVA 101 Query: 89 LGRKLIEAT---FAERVVFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGRS 145 L KL E T F ++ +F+NSG EA E A K+AR Y + +++F FHGR+ Sbjct: 102 LAEKLAELTPGNFEKKAMFLNSGAEAVENAIKIARRYTG------RPAVVSFTRGFHGRT 155 Query: 146 LFTVSVGGQPK-YSDGFGPKPADIIHVPFNDLHAVKAVMDDH------------------ 186 L +S+ + K Y GP + P+ ++ A M + Sbjct: 156 LMGMSLTSKVKPYKYQMGPFAPMVYQAPYPYVYRRPAGMSEEEYTDSVIAQFKEFFSAEV 215 Query: 187 ----TCAVVVEPIQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYM 242 AV+ EP+QGEGG F+ ++E C QH+ + + DE+Q G GRTG FA Sbjct: 216 SPEEVAAVIFEPVQGEGGFIVPPKRFVDAVKEFCAQHRIVFIADEIQTGFGRTGRWFASE 275 Query: 243 HYGVTPDILTSAKALGGGFPISAMLTTAEIASAFHPGSHGSTYGGNPLACAVAGAAFDII 302 H+G+ PD++T +K+L G PIS ++ AEI A PG G TYGG+PL CA A + + Sbjct: 276 HFGLEPDLITVSKSLAAGLPISGVVGRAEIMDAAEPGQLGGTYGGSPLGCAAALGVIETM 335 Query: 303 NTPEVLEGIQAKRQRFVDHLQKIDQQYDVFSDIRGMGLLIGAEL------KPQYKGRARD 356 +++ + ++ +D + ++Y + D+RG+G + EL + K Sbjct: 336 QRENLVQKAEVLGRQLIDRFTRWYERYPLIGDVRGLGAMAAVELVRDRQTREPAKDETAR 395 Query: 357 FLYAGAEAGVMVLNAG--PDVMRFAPSLVVEDADIDEGMQRFAHAVAKVVGA 406 + + GV+++ AG DV+R LV ++DEG+ A+A+V GA Sbjct: 396 VIQGSVQRGVLLMGAGLYSDVIRILCPLVTTPEELDEGLDVVEEALAEVSGA 447 Lambda K H 0.322 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 453 Length adjustment: 32 Effective length of query: 374 Effective length of database: 421 Effective search space: 157454 Effective search space used: 157454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory