Align cystathionine gamma-lyase (EC 4.4.1.1); cysteine-S-conjugate beta-lyase (EC 4.4.1.13) (characterized)
to candidate WP_013076055.1 BTUS_RS10490 PLP-dependent aspartate aminotransferase family protein
Query= BRENDA::A2RM21 (380 letters) >NCBI__GCF_000092905.1:WP_013076055.1 Length = 393 Score = 394 bits (1013), Expect = e-114 Identities = 190/374 (50%), Positives = 261/374 (69%) Query: 4 IKTKVIHGGISTDKTTGAVSVPIYQTSTYKQNGLGQPKEYEYSRSGNPTRHALEELIADL 63 I T+ G D TTGA+S+PI+ +TY GLG ++Y+R+ NPTR ALEE IA L Sbjct: 3 IDTRCSQAGNRRDPTTGAISLPIHHATTYAHPGLGSSTGFDYTRTSNPTRLALEETIAAL 62 Query: 64 EGGVQGFAFSSGLAGIHAVLSLFSAGDHIILADDVYGGTFRLMDKVLTKTGIIYDLVDLS 123 GG +GFAF+SG+A I A+ LF GDH++L+DD+YGGT+RL ++ G+ VD S Sbjct: 63 HGGCRGFAFASGMAAIDAIARLFRPGDHLVLSDDLYGGTYRLFERFFRPLGLETTYVDTS 122 Query: 124 NLDDLKAAFKEETKAIYFETPSNPLLKVLDIKEISAIAKAHDALTLVDNTFATPYLQQPI 183 +L + + T+A++ ETP+NP LK+ D+K +S +A +VDNTF TPYLQ+P+ Sbjct: 123 DLQAVAKQIRPRTRALFVETPTNPTLKIADLKGLSQVAHERGLWLIVDNTFMTPYLQRPL 182 Query: 184 ALGADIVLHSATKYLGGHSDVVAGLVTTNSKELASEIGFLQNSIGAVLGPQDSWLVQRGI 243 LGADIV+ SATKYLGGH+DV+AG V S+ LA+ + F+QNSIGAVLGPQD+WL+ RGI Sbjct: 183 ELGADIVVESATKYLGGHNDVLAGTVVVKSEALANSLAFIQNSIGAVLGPQDAWLLLRGI 242 Query: 244 KTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLNSHPGHEIAKKQMSAFGGMISFELT 303 KTL +RM+ H NA+ +AE+L VS+VYYPGL HPGH + + Q S +GGMI+FE+ Sbjct: 243 KTLHVRMDRHEGNARTLAEWLRAHPRVSRVYYPGLPDHPGHAVHRAQASGWGGMIAFEVP 302 Query: 304 DENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTHASIPKELREEIGIKDGLIRLSVGV 363 + V + +L T AESLGG ESLI PAV THA +P ++R+ +G+ D L+RLSVG+ Sbjct: 303 NNRWVPPILAHLRVITFAESLGGTESLITYPAVQTHADVPPDVRQRLGVTDSLLRLSVGL 362 Query: 364 EAIEDLLTDIKEAL 377 E ++DL+ D+ +AL Sbjct: 363 EHVDDLIQDLDQAL 376 Lambda K H 0.315 0.133 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 393 Length adjustment: 30 Effective length of query: 350 Effective length of database: 363 Effective search space: 127050 Effective search space used: 127050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory