Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_013256927.1 DEBA_RS00455 pyridoxal phosphate-dependent aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_000143965.1:WP_013256927.1 Length = 395 Score = 221 bits (564), Expect = 2e-62 Identities = 131/374 (35%), Positives = 201/374 (53%), Gaps = 11/374 (2%) Query: 18 VLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHGYVLSNGILECRQAVT 77 VL A++L+AQG+ +IHL +G+PDF TP+ + AA+KA+ G Y S G+LE RQA+ Sbjct: 18 VLERAQELQAQGRDIIHLEVGEPDFDTPEAIKAAAQKAMTGGQTHYTHSLGLLELRQAIA 77 Query: 78 RKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGA--EIIHPTPAFPIYESMINYTG 135 + Y +DP RVL+ G P M EPG E+I P + Y + IN+ G Sbjct: 78 AHYGRRYGVTVDPGRVLVSSGTSPAMLLMFAALIEPGQGHEVILSDPCYACYPNFINFVG 137 Query: 136 STPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVE---KSAIDVLAEGL 192 + ED ++ PE I + + KTR +++ +P NPTG ++ +AI LA G Sbjct: 138 GQVARVPVAEDDAFQYRPEAIAAAMNAKTRAIVINSPANPTGQLLDAGRMAAIAALAPGR 197 Query: 193 KKHPHVAILSDEIYSRQIYDGKEMPTFFNYPDLQDRLIVLDGWSKAYAMTGWRMGWSVWP 252 P+V +SDEIY +Y+G+E + + VL G+SK +AMTGWR+G+ + P Sbjct: 198 PGGPYV--VSDEIYHGLVYEGRE----HSILEFTQDAFVLGGFSKLHAMTGWRLGYLIMP 251 Query: 253 EELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRKLIHEGLNSLPG 312 + + + K+ N C + +Q+AG+AAL +D + M+ + QRR+++ +GL L Sbjct: 252 QAYVRPLQKMHQNFAICAPSMAQWAGVAALTQAEDDLARMVGVYAQRRRVMIDGLRGLGF 311 Query: 313 VECSLPGGAFYAFPKVIGTGMNGSEFAKKCMHEAGVAIVPGTAFGKTCQDYVRFSYAASQ 372 P GAFY + + A + AGVA+ PG FG ++RFSYA SQ Sbjct: 312 KIPHEPCGAFYVLTRCDHLDPDDYRLAFHILENAGVAVTPGRDFGPGGHGFLRFSYANSQ 371 Query: 373 DNISNALENIKKML 386 +NI A+ + + L Sbjct: 372 ENILRAMARLAEYL 385 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 395 Length adjustment: 31 Effective length of query: 356 Effective length of database: 364 Effective search space: 129584 Effective search space used: 129584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory