Align Prephenate dehydrogenase (characterized, see rationale)
to candidate WP_013257307.1 DEBA_RS02390 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= uniprot:A0A1L6J750 (249 letters) >NCBI__GCF_000143965.1:WP_013257307.1 Length = 259 Score = 86.3 bits (212), Expect = 6e-22 Identities = 61/179 (34%), Positives = 92/179 (51%), Gaps = 12/179 (6%) Query: 51 AADCDVVMLAVPVQAMAATIAAIAPLVRPGALVLDVASVKMLPARWMLEALPESVDIVAT 110 A +C V++LAVPV M +A + PL RP LV+D+ S+K P + ML V V Sbjct: 50 AQNCHVLVLAVPVGQMTTVMAELGPLTRPDGLVVDLCSLKETPLQAMLAHARGQV--VGC 107 Query: 111 HPLFGPQSARGGLEGQPLVVCAVRGERH-HKVAEFGRSLGLSVSITTAEEHDREMAYVQA 169 HPLFGP + GL+GQ + +C RG+ ++ F + +V TA EHD+ MA VQ+ Sbjct: 108 HPLFGPTA--NGLDGQTVFLCPGRGQSWLERLQNFLHTQNANVVSLTATEHDKLMAIVQS 165 Query: 170 LTHL----IGRALVNIRIPDEELKTNS---YQHLLELCGLIRDDSKELFFAIQNLNPYA 221 L H+ +G+ L N I + + + + HL +L L+ + NP+A Sbjct: 166 LRHILVAALGQTLANSDINLKAILPMAGPWFNHLAQLLQNQAAQPASLYAHLATQNPHA 224 Lambda K H 0.321 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 259 Length adjustment: 24 Effective length of query: 225 Effective length of database: 235 Effective search space: 52875 Effective search space used: 52875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory