Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54); chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_013260004.1 DEBA_RS16065 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::P39912 (358 letters) >NCBI__GCF_000143965.1:WP_013260004.1 Length = 346 Score = 267 bits (682), Expect = 4e-76 Identities = 136/269 (50%), Positives = 183/269 (68%) Query: 82 GLELQEEDHSKALLVSRKKKPEDTIVDIKGEKIGDGQQRFIVGPCAVESYEQVAEVAAAA 141 G+E + H+ LV R + + ++V + G IG + I GPCAVE E + + A A Sbjct: 62 GVEEVSDFHTDWKLVWRGPEQQTSVVRMGGRSIGGPELMVIAGPCAVECRENLLQTAQAV 121 Query: 142 KKQGIKILRGGAFKPRTSPYDFQGLGVEGLQILKRVADEFDLAVISEIVTPAHIEEALDY 201 G +RGGAFKPRTSPY F+GLG EGL+ L + L V++E+++ +E Y Sbjct: 122 AASGAGAIRGGAFKPRTSPYSFRGLGEEGLKYLAEARELTGLPVVTEVMSFHEVELVARY 181 Query: 202 IDVIQIGARNMQNFELLKAAGAVKKPVLLKRGLAATISEFINAAEYIMSQGNDQIILCER 261 DV+QIGARNMQNF LL+AAG V KPVLLKRGL T+ E + AEYI+++GN Q++ CER Sbjct: 182 ADVLQIGARNMQNFALLEAAGEVDKPVLLKRGLGNTVKELLLCAEYILARGNQQVMFCER 241 Query: 262 GIRTYETATRNTLDISAVPILKQETHLPVFVDVTHSTGRRDLLLPTAKAALAIGADGVMA 321 GIRT+ET TRNTLD++AVPILKQ +HLPV VD +H+ G+R+L+ A AA+A GADG+M Sbjct: 242 GIRTFETETRNTLDLAAVPILKQNSHLPVVVDPSHAAGKRELVPALALAAVAAGADGLMI 301 Query: 322 EVHPDPSVALSDSAQQMAIPEFEKWLNEL 350 EVHP+P+ ALSD Q + +P F+ + L Sbjct: 302 EVHPEPAKALSDGRQTIDLPAFDDLMKRL 330 Lambda K H 0.316 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 346 Length adjustment: 29 Effective length of query: 329 Effective length of database: 317 Effective search space: 104293 Effective search space used: 104293 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory