Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate WP_013258679.1 DEBA_RS09355 LL-diaminopimelate aminotransferase
Query= BRENDA::Q56232 (385 letters) >NCBI__GCF_000143965.1:WP_013258679.1 Length = 388 Score = 199 bits (507), Expect = 8e-56 Identities = 128/383 (33%), Positives = 196/383 (51%), Gaps = 12/383 (3%) Query: 5 SRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKT-K 63 + R+Q + P ++ ++R +GVD++ L G+PD TP H+ EA A +T K Sbjct: 6 AERLQKLPPYLFQELDRLRDQVRARGVDIIDLGVGDPDQPTPPHIIEALNAAAQDPRTHK 65 Query: 64 YAPPAGIPELREALAEKFRRENGLSVTPEETIVT-VGGKQALFNLFQAILDPGDEVIVLS 122 Y +G+ RE A+ ++R + + P + ++T +G K+ L + A ++PGD V+ S Sbjct: 66 YPAYSGLSRFREVAADWYKRRFDVDLIPNQEVITLIGSKEGLAHFPLAFVNPGDVVLTPS 125 Query: 123 PYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYP 182 P + Y AGGV VE+ E GF+PD + A+ + K +V+N PNNPT A Sbjct: 126 PAYPVYKGSTILAGGVPVEMPLRKENGFLPDLAAMDPALLQKAKVMVINYPNNPTAACAD 185 Query: 183 KEVLEALARLAVEHDFYLVSDEIYEHLLYEG---EHFSPGRVAPEHTLTVNGAAKAFAMT 239 E E +A LA +H+ +VSD Y + Y+G F A E + + +K + MT Sbjct: 186 LEFYERVAALAKKHEIIVVSDAAYTEMAYDGYRPPSFMQVAGAREVGIEFHSLSKTYNMT 245 Query: 240 GWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRR 299 GWRIG+A G +++ + V SQ + Q A + ALT AS+ V + Y R Sbjct: 246 GWRIGFAVGNAQLVAGLGQVKSQIDSGAFDAVQLAGITALT---ASQDCVAQMNKLYAGR 302 Query: 300 RDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLL-EAGVAVVPGTDF--AA 356 R++L++GL LGL+ RP FYV P +LL EAGV PG F A Sbjct: 303 REVLVKGLQGLGLEVERPKATFYVWCGV-PAGQTSTDFCRKLLEEAGVVSTPGVGFGSAG 361 Query: 357 FGHVRLSYATSEENLRKALERFA 379 G+VR + E L++A++R A Sbjct: 362 EGYVRFALTVDEARLQEAVDRLA 384 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 388 Length adjustment: 30 Effective length of query: 355 Effective length of database: 358 Effective search space: 127090 Effective search space used: 127090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory