Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate WP_013421023.1 RVAN_RS17470 aspartate-semialdehyde dehydrogenase
Query= SwissProt::P23247 (337 letters) >NCBI__GCF_000166055.1:WP_013421023.1 Length = 341 Score = 331 bits (849), Expect = 1e-95 Identities = 174/332 (52%), Positives = 231/332 (69%), Gaps = 5/332 (1%) Query: 5 FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDW 64 +NVA+ GATG VG M+ +L EREFPV E+F +AS RS G F KT++ Q++ FD+ Sbjct: 3 YNVAVVGATGNVGREMMNILDEREFPVKEVFAIASRRSVGMEVSFGDKTLKCQDLATFDF 62 Query: 65 SQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNR 124 S+ AL SAGG++S +WAP A+ G VVIDN+S +RYD D+PL+VPEVN +A+A FR + Sbjct: 63 SRCDFALLSAGGDVSKEWAPKIAKTGCVVIDNSSAWRYDMDVPLIVPEVNADAVAGFRKK 122 Query: 125 NIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYP 184 NIIANPNCST Q++VALKP++DA I+R+ V TYQSVSGAGK +DEL QT + Sbjct: 123 NIIANPNCSTAQLVVALKPLHDAATIKRVVVDTYQSVSGAGKEAMDELWNQTKGIYVTDA 182 Query: 185 AETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYG 244 F++QIAFN IP ID F+D+G+TKEE KMV ET+KI DP I + TCVRVPVF G Sbjct: 183 PTPEVFTKQIAFNVIPHIDVFLDDGFTKEEWKMVAETKKIL-DPKIKLVATCVRVPVFVG 241 Query: 245 HAEAVHVETRAPIDAEQVMDMLEQTDG---IELFRGADFPTQVRDAGGKDHVLVGRVRND 301 H+EAV++E PI A++ ++L + G I+ + T V + G V R+R D Sbjct: 242 HSEAVNIEFENPISAQEAREILREAPGVLVIDKREDGGYITPV-ECVGDFATYVSRIRED 300 Query: 302 ISHHSGINLWVVADNVRKGAATNAVQIAELLV 333 + +G++LWVV+DN+RKGAA N VQIAELL+ Sbjct: 301 PTVENGLSLWVVSDNLRKGAALNTVQIAELLI 332 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 341 Length adjustment: 28 Effective length of query: 309 Effective length of database: 313 Effective search space: 96717 Effective search space used: 96717 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_013421023.1 RVAN_RS17470 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.2625969.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-147 475.1 0.2 6.7e-147 474.9 0.2 1.0 1 NCBI__GCF_000166055.1:WP_013421023.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000166055.1:WP_013421023.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 474.9 0.2 6.7e-147 6.7e-147 1 338 [. 4 333 .. 4 334 .. 0.99 Alignments for each domain: == domain 1 score: 474.9 bits; conditional E-value: 6.7e-147 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsaGgsv 73 nva+vGatG+vG+e++++L+er+fp++++ ++as+rs G +v f +k l+ +++ +++f++ d al saGg v NCBI__GCF_000166055.1:WP_013421023.1 4 NVAVVGATGNVGREMMNILDEREFPVKEVFAIASRRSVGMEVSFGDKTLKCQDLATFDFSRCDFALLSAGGDV 76 79*********************************************************************** PP TIGR01296 74 skefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkplkdeaklk 146 ske+apk+ak+g++viDn+sa+r d dvPL+vpevna+ ++ ++kk+iianPnCst qlvv+Lkpl+d+a +k NCBI__GCF_000166055.1:WP_013421023.1 77 SKEWAPKIAKTGCVVIDNSSAWRYDMDVPLIVPEVNADAVAGFRKKNIIANPNCSTAQLVVALKPLHDAATIK 149 ************************************************************************* PP TIGR01296 147 rvvvstYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidklkedGytkeelkl 219 rvvv tYq+vsGaGk++++eL nqtk ++++ + ++ f+kqiafn+ip+id + +dG+tkee k+ NCBI__GCF_000166055.1:WP_013421023.1 150 RVVVDTYQSVSGAGKEAMDELWNQTKGIYVTDAPT-------PEVFTKQIAFNVIPHIDVFLDDGFTKEEWKM 215 ****************************9876555.......699**************************** PP TIGR01296 220 lfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvviddpsenlyptPleav 292 + et+kil+ +++k+ atcvrvPvf+ghse+v+iefe+++s++e++e+L+eapgv vid+ ++ y+tP+e v NCBI__GCF_000166055.1:WP_013421023.1 216 VAETKKILD-PKIKLVATCVRVPVFVGHSEAVNIEFENPISAQEAREILREAPGVLVIDKREDGGYITPVECV 287 *********.*************************************************************** PP TIGR01296 293 gkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaellik 338 g +++v+rir+D + e+gl+l+vv+DnlrkGaaln+vqiaelli+ NCBI__GCF_000166055.1:WP_013421023.1 288 GDFATYVSRIREDPTVENGLSLWVVSDNLRKGAALNTVQIAELLIN 333 ********************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (341 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 16.73 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory