Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_013418943.1 RVAN_RS06420 pyridoxal phosphate-dependent aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_000166055.1:WP_013418943.1 Length = 400 Score = 231 bits (590), Expect = 2e-65 Identities = 138/393 (35%), Positives = 205/393 (52%), Gaps = 13/393 (3%) Query: 3 LAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHG 62 L+ L R+ +V ++A++L+A GK +I LG G+PDF TP ++ +AA KA+ +G Sbjct: 4 LSDALARVKPSPTIAVSSKARELKAAGKDVISLGAGEPDFDTPDNIKEAAIKAIRDGKTK 63 Query: 63 YVLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPTP 122 Y +GI E +QA+ K K+ N D P +V+ PGGK ++ A+ PG E++ P P Sbjct: 64 YTNVDGIPELKQAICAKFKRENNLDYKPSQVMAAPGGKKVIFNAMVATLNPGDEVVIPAP 123 Query: 123 AFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEK 182 + Y ++ G T V + K PE + + IT +T+ +I +P+NPTG+ + Sbjct: 124 YWVSYPDIVLLAGGTCVFAEAGIGTKFKLSPETLEAAITPRTKWVIFNHPSNPTGAAYTR 183 Query: 183 SAIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNY-PDLQDRLIVLDGWSKAYAM 241 + L + L +HP V +LSD++Y +YDG + T P L DR + ++G SKAYAM Sbjct: 184 DELKALTDVLLRHPQVWVLSDDMYEHLVYDGFKFTTPAEVEPKLYDRTLTVNGVSKAYAM 243 Query: 242 TGWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRK 301 TGWR+G+ PE LI + L + S + SQ+A + AL+G D + F QRR Sbjct: 244 TGWRIGYCGGPEALIKAMTTLQSQTTSNPTSISQWASVEALNGTQDFLPVRAENFKQRRD 303 Query: 302 LIHEGLNSLPGVECSLPGGAFYAFPKVIG----------TGMNGSEFAKKCMHEAGVAIV 351 LI LN G+ C P GAFY FP G N + + + GVA+V Sbjct: 304 LIVSLLNDAEGITCPTPEGAFYVFPSCAGLIGKKTPGGKVLENDEDVVTALLEDEGVAVV 363 Query: 352 PGTAFGKTCQDYVRFSYAASQDNISNALENIKK 384 G AFG Y R SYA S + A I++ Sbjct: 364 HGAAFG--LSPYFRISYATSAKELEEAGRRIQR 394 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 400 Length adjustment: 31 Effective length of query: 356 Effective length of database: 369 Effective search space: 131364 Effective search space used: 131364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory