Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_013417919.1 RVAN_RS01125 branched-chain amino acid aminotransferase
Query= reanno::BFirm:BPHYT_RS16285 (307 letters) >NCBI__GCF_000166055.1:WP_013417919.1 Length = 305 Score = 233 bits (595), Expect = 3e-66 Identities = 117/263 (44%), Positives = 168/263 (63%), Gaps = 5/263 (1%) Query: 6 RDGKIWMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADGGTAIFRLQEHTKRLLN 65 RDG IWMDG L+ WRDAK+HVLTH LHYG GVFEG R Y+ +F + H +RL Sbjct: 12 RDGFIWMDGGLVPWRDAKVHVLTHALHYGSGVFEGARIYEGE-----VFASRRHAERLRA 66 Query: 66 SAKIFQMDVPFDHETLAAAQCEVVRENKLESCYLRPIIWVGSEKLGVSAKGNTIHVAIAA 125 SA+I +VP+ E L A +V++ KL+ Y+RP+ W G E++GV+AK + IHVA+A Sbjct: 67 SAEILGFEVPYSAEQLEQAFRDVIKAQKLDEGYIRPVAWRGPEEMGVAAKHSKIHVAVAV 126 Query: 126 WPWGAYLGEDGIAKGIRVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADGYDEAL 185 W WG+Y + KGIR+ + + R + AKA+G Y+ + ++ GY++AL Sbjct: 127 WDWGSYFPMEERLKGIRLCFAKYRRPDPATAPSTAKAAGLYMICTIEKHRSMDLGYNDAL 186 Query: 186 LLDVDGYVSEGSGENFFLVNNGKLYTPDLSSCLDGITRDTVITLARDAGIQVIEKRITRD 245 +LD GYV+E +G N F V +G+++TPD L+GITR T+I A+ GI V E+RI + Sbjct: 187 MLDWRGYVAEATGANIFFVKDGQIHTPDADCFLNGITRQTLIAQAKARGITVHERRIQPE 246 Query: 246 EVYTCDEAFFTGTAAEVTPIREL 268 E+ ++ F TG+AAEVTP+ E+ Sbjct: 247 EMAGFEQCFLTGSAAEVTPVSEI 269 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 305 Length adjustment: 27 Effective length of query: 280 Effective length of database: 278 Effective search space: 77840 Effective search space used: 77840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_013417919.1 RVAN_RS01125 (branched-chain amino acid aminotransferase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.3324320.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-91 292.9 0.0 1.5e-91 292.6 0.0 1.0 1 NCBI__GCF_000166055.1:WP_013417919.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000166055.1:WP_013417919.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 292.6 0.0 1.5e-91 1.5e-91 1 287 [. 17 294 .. 17 303 .. 0.97 Alignments for each domain: == domain 1 score: 292.6 bits; conditional E-value: 1.5e-91 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskeelvev 73 w+dG lv+++dakvhvlthalhYG+gvfeG R+Ye+ +f + h+eRl sa+il +e+pys+e+l ++ NCBI__GCF_000166055.1:WP_013417919.1 17 WMDGGLVPWRDAKVHVLTHALHYGSGVFEGARIYEG----EVFASRRHAERLRASAEILGFEVPYSAEQLEQA 85 9***********************************....8******************************** PP TIGR01122 74 tkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssfrraavnsi 146 ++v+++++l++ YiRp++++G e++g+ +k + k++v++a+w+wg y+ e kGi+ + +rr ++ + NCBI__GCF_000166055.1:WP_013417919.1 86 FRDVIKAQKLDEGYIRPVAWRGPEEMGVAAK-HSKIHVAVAVWDWGSYFPMEERLKGIRLCFAKYRRPDPATA 157 ******************************5.559*****************9******************** PP TIGR01122 147 ptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvsesiLkgitrdavik 219 p++akaag Y+ ++ k+ ++ Gy++a++Ld Gyvae +G nif vkdg++ tP+ + L+gitr+++i NCBI__GCF_000166055.1:WP_013417919.1 158 PSTAKAAGLYMICTIEKHRSMDLGYNDALMLDWRGYVAEATGANIFFVKDGQIHTPDA-DCFLNGITRQTLIA 229 *********************************************************9.99************ PP TIGR01122 220 lakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkklqeaffdlvegk 287 ak +gi+v+e+ri ee+ + fltG+aaevtP+ e+ + + ++G++tk l+e+++ l + NCBI__GCF_000166055.1:WP_013417919.1 230 QAKARGITVHERRIQPEEMAGFEQCFLTGSAAEVTPVSEIGEYRF---TVGEITKSLMEEYSALARPS 294 ****************************************99986...689***********998764 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (305 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 17.18 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory