Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_005345775.1 EUBHAL_RS05010 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_000173975.1:WP_005345775.1 Length = 391 Score = 342 bits (878), Expect = 8e-99 Identities = 174/387 (44%), Positives = 256/387 (66%), Gaps = 3/387 (0%) Query: 1 MEHLLNPKAREIEISGIRKFSNLVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTS 60 M + L+ K +++ SGIRKF +LV + D ISL +G+PDF TP H++ ++++ T Sbjct: 1 MRNPLSDKVVQMKPSGIRKFFDLVQEMPDAISLGVGEPDFDTPWHIREEGIYSLEKGRTF 60 Query: 61 YTPNAGYLELRQAVQLYMKKKADFNYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPG 120 YT NAG LELR+A+ YM +K + Y+ EI++T G S+ ID A R +L+PGDEVI+P Sbjct: 61 YTSNAGLLELRKAIAHYMYRKYELTYNPAHEIVVTVGGSEGIDLALRAMLNPGDEVILPE 120 Query: 121 PIYPGYEPIINLCGAKPVIVDTTSHG-FKLTARLIEDALTPNTKCVVLPYPSNPTGVTLS 179 P + Y P + L PV +D FKL + +T TK ++L YP+NPTG ++ Sbjct: 121 PAFVSYLPCVKLADGVPVTIDLKEENHFKLKPEELLAVITDKTKILILSYPNNPTGAIMT 180 Query: 180 EEELKSIAALLKGRNVFVLSDEIYSELTYDRPHYSIATY--LRDQTIVINGLSKSHSMTG 237 E+L+ IA ++K ++++V+SDEIY+ELTY + H SIA+ +RD+TI+ING SKS +MTG Sbjct: 181 REDLEPIAEIVKEKDLYVISDEIYAELTYGQDHCSIASLPGMRDRTIIINGFSKSFAMTG 240 Query: 238 WRIGFLFAPKDIAKHILKVHQYNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLDYV 297 WR+GF P+ I + ILK+HQ+ + A + SQ AA+EA+TNG +D IMR Y +R +V Sbjct: 241 WRMGFATGPELIMQQILKIHQFAIMAAPTTSQYAAIEAMTNGEEDVQIMRNAYNQRRRFV 300 Query: 298 YDRLVSMGLDVVKPSGAFYIFPSIKSFGMTSFDFSMALLEDAGVALVPGSSFSTYGEGYV 357 + MGL +P GAFYIFP IK FGMTS +F+ L + VA++PG++F GEG++ Sbjct: 301 LELFSEMGLKCFEPEGAFYIFPCIKEFGMTSDEFANRFLREEKVAIIPGTAFGDCGEGFL 360 Query: 358 RLSFACSMDTLREGLDRLELFVLKKRE 384 R+S+A S++ L+E L RL FV + R+ Sbjct: 361 RVSYAYSIEELKEALGRLANFVERLRK 387 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 391 Length adjustment: 31 Effective length of query: 362 Effective length of database: 360 Effective search space: 130320 Effective search space used: 130320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory