Align kynurenine-oxoglutarate transaminase (EC 2.6.1.7) (characterized)
to candidate WP_005345775.1 EUBHAL_RS05010 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= BRENDA::Q16773 (422 letters) >NCBI__GCF_000173975.1:WP_005345775.1 Length = 391 Score = 177 bits (450), Expect = 4e-49 Identities = 111/347 (31%), Positives = 176/347 (50%), Gaps = 42/347 (12%) Query: 29 DVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQ----YTKTFGYPPLTKILASFFGELL 84 D ++LG G PDF P E G + L + YT G L K +A + Sbjct: 29 DAISLGVGEPDFDTPWHIRE------EGIYSLEKGRTFYTSNAGLLELRKAIAHYMYRKY 82 Query: 85 GQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSL 144 +P ++VTVGG + A +A+++ GDEVI+ EP F Y P +A G PV + L Sbjct: 83 ELTYNPAHEIVVTVGGSEGIDLALRAMLNPGDEVILPEPAFVSYLPCVKLADGVPVTIDL 142 Query: 145 KPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQ 204 K ++++L P EL T +TK L+L+ PNNP G + +RE+LE +A + + Sbjct: 143 K----------EENHFKLKPEELLAVITDKTKILILSYPNNPTGAIMTREDLEPIAEIVK 192 Query: 205 QHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDH 264 + D+ I+DE+Y + Y G H SIASLPGM +RT+ I K+F+ TGW++G+ GP+ Sbjct: 193 EKDLYVISDEIYAELTY-GQDHCSIASLPGMRDRTIIINGFSKSFAMTGWRMGFATGPEL 251 Query: 265 IMKHLRTVHQNSVFHCPTQSQAAVAESF---EREQLLFRQPSSYFVQFPQAMQRCRDHMI 321 IM+ + +HQ ++ PT SQ A E+ E + + R A + R ++ Sbjct: 252 IMQQILKIHQFAIMAAPTTSQYAAIEAMTNGEEDVQIMR----------NAYNQRRRFVL 301 Query: 322 RSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVK 368 +GLK P+G++++ I +F G + + RF++ Sbjct: 302 ELFSEMGLKCFEPEGAFYIFPCIKEF--------GMTSDEFANRFLR 340 Lambda K H 0.323 0.139 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 422 Length of database: 391 Length adjustment: 31 Effective length of query: 391 Effective length of database: 360 Effective search space: 140760 Effective search space used: 140760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory