Align Prephenate dehydrogenase protein; EC 1.3.1.12 (characterized, see rationale)
to candidate WP_013537390.1 THEAM_RS03215 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= uniprot:D8IR44_HERSS (295 letters) >NCBI__GCF_000185805.1:WP_013537390.1 Length = 287 Score = 209 bits (532), Expect = 6e-59 Identities = 111/283 (39%), Positives = 170/283 (60%), Gaps = 6/283 (2%) Query: 2 FKKVVIFGVGLIGGSFALALRRAGQAAHIVGVGRSLQSLERARELGIIDAVATDAASAVQ 61 FK++ I G+GLIGGSFAL LR G I V + +++E+ EL +ID+ + + A + Sbjct: 5 FKEICIIGLGLIGGSFALNLRLKGFPGKITAVDINPEAIEKGLELEVIDSGSIKHSMA-E 63 Query: 62 GADLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQFIPAH 121 ADL+++A PV P+L + PHL +V+D GS K +V L D F+ H Sbjct: 64 SADLVVLATPVGAYEPVLKQLKPHLNGSQVVSDLGSVKGKLVYRCEELLADT-APFVGGH 122 Query: 122 PIAGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQEHDA 181 PIAG EK G E+A+ +L+ G K ++T D +E V W+ G+ + ++P HD Sbjct: 123 PIAGTEKSGVESAVPDLFVGAKFIVTPTENTDPKALEKVKRLWKQLGSEVIEMAPYHHDR 182 Query: 182 VFASVSHLPHVLAFALV---DDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLA 238 VFA+VSHLPHV+A+++V DD++ + + LF++ GFRDFTRIA S P MWRDI LA Sbjct: 183 VFAAVSHLPHVVAYSIVSAIDDLSEQVN-TNLFEFTGGGFRDFTRIAMSDPIMWRDICLA 241 Query: 239 NRDALLTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQ 281 NR+ LL + ++ L+ + +I G+G G+++ + A+ R+ Sbjct: 242 NRENLLNSIKSFKSALEKVEKLIEEGNGEGLKEFFEKAREKRK 284 Lambda K H 0.320 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 287 Length adjustment: 26 Effective length of query: 269 Effective length of database: 261 Effective search space: 70209 Effective search space used: 70209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory