Align aspartate transaminase; EC 2.6.1.1 (characterized)
to candidate WP_013537432.1 THEAM_RS03435 pyridoxal phosphate-dependent aminotransferase
Query= CharProtDB::CH_017144 (393 letters) >NCBI__GCF_000185805.1:WP_013537432.1 Length = 395 Score = 414 bits (1065), Expect = e-120 Identities = 208/392 (53%), Positives = 273/392 (69%) Query: 1 MKLAKRVASLTPSATLAITEKAKELKAAGHDVIGLGAGEPDFNTPQHILDAAIKAMNEGH 60 MKL++RV +++PS T+AIT KAKELKA G DVIG GAGEPDF+TP HI +AA +A++ G Sbjct: 1 MKLSRRVLNMSPSPTMAITSKAKELKAKGVDVIGFGAGEPDFDTPYHIKEAAKEAIDMGF 60 Query: 61 TKYTPSGGLPALKEEIIKKFARDQGLDYEPAEVIVCVGAKHALYTLFQVLLDEGDEVIIP 120 TKYTP G+P L+ + K R+ G+ YEP +V++ GAK AL+ L ++DEGDEVIIP Sbjct: 61 TKYTPPAGIPELRRAVADKLERENGISYEPEQVVITDGAKQALFNLMLSVVDEGDEVIIP 120 Query: 121 TPYWVSYPEQVKLAGGVPVYVEGLEQNHFKITPEQLKQAITPRTKAVIINSPSNPTGMIY 180 PYWV+YPEQVK AGG PV+VE E F +T E+LK A+T +TK VI+ +P NPTG + Sbjct: 121 APYWVTYPEQVKFAGGRPVFVETKEIKGFALTLEELKPAVTSKTKMVILCTPHNPTGSVI 180 Query: 181 TAEELKALGEVCLAHGVLIVSDEIYEKLTYGGAKHVSIAELSPELKAQTVIINGVSKSHS 240 EEL+ +GE C G+LI SDE YE LTY G KH SIA LS E+KA TV IN +SK+ S Sbjct: 181 PKEELQRIGEFCAERGILIASDECYEYLTYDGFKHTSIASLSEEIKAVTVTINALSKAFS 240 Query: 241 MTGWRIGYAAGPKDIIKAMTDLASHSTSNPTSIAQYAAIAAYSGPQEPVEQMRQAFEQRL 300 MTGWR+GYAAGPK+II AM + S S SN SIAQ AA+AA + P++ +++ +AF+QR Sbjct: 241 MTGWRVGYAAGPKEIIDAMIKINSQSISNVNSIAQKAAVAALTKPKDFLKEWLEAFDQRR 300 Query: 301 NIIYDKLVQIPGFTCVKPQGAFYLFPNAREAAAMAGCRTVDEFVAALLEEAKVALVPGSG 360 + + L IPG +C+ P+GAFY FPN +E + + LL EAK+A+VPGS Sbjct: 301 RYMVETLNSIPGVSCLMPKGAFYAFPNVKELLKLGNFKDDWALAEFLLSEAKIAVVPGSA 360 Query: 361 FGAPDNVRLSYATSLDALETAVERIHRFMEAR 392 FG P +RLSYATS++ +E + R +E R Sbjct: 361 FGYPGYLRLSYATSMENIEEGLRRFKEAVERR 392 Lambda K H 0.316 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 395 Length adjustment: 31 Effective length of query: 362 Effective length of database: 364 Effective search space: 131768 Effective search space used: 131768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory