Align Beta-phenylalanine transaminase; Aromatic beta-amino acid aminotransferase; Beta-phenylalanine aminotransferase; VpAT; EC 2.6.1.- (characterized)
to candidate WP_013538342.1 THEAM_RS08090 glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::H8WR05 (434 letters) >NCBI__GCF_000185805.1:WP_013538342.1 Length = 433 Score = 224 bits (570), Expect = 5e-63 Identities = 137/418 (32%), Positives = 218/418 (52%), Gaps = 25/418 (5%) Query: 24 SQRQFEAQARYMPGANSRSVLFY---APFPLTIARGEGAALWDADGHRYADFIAEYTAGV 80 S+ FE +Y+PG + V + P I R +G+ +WD DG+ Y D++ + + Sbjct: 6 SKALFEEAKKYIPGGVNSPVRAFKSVGDVPRFIERAKGSHIWDVDGNEYIDYVCSWGPMI 65 Query: 81 YGHSAPEIRDAVIEAMQGGINLTGHNLLEGRLARLICERFPQIEQLRFTNSGTEANLMAL 140 GH+ P++ +A+ + + G + LE LA++I E P +E++R NSGTEA + A+ Sbjct: 66 LGHAHPKVVEAIQKQAEKGTSYGAPTELEVELAKMIVELVPSVEKVRMVNSGTEATMSAI 125 Query: 141 TAALHFTGRRKIVVFSGGYHG-----------GVLGFGARPSPTTVPFDF----LVLPYN 185 A +TGR K++ F GGYHG G+ FG SP +P DF + +P+N Sbjct: 126 RLARGYTGRNKVIKFEGGYHGHVDALLVKAGSGLTTFGVPTSP-GIPEDFAKHTITVPFN 184 Query: 186 DAQTARAQIERHGPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFDEVMTS 245 D + I+ G ++A V++EP+ +G I +P FL+A+RE + G +L+FDEV+T Sbjct: 185 DIDALKRVIDEVGHDVAAVIMEPVMANAGLIIPEPGFLEAVRELTAEKGIVLIFDEVITG 244 Query: 246 -RLAPHGLANKLGIRSDLTTLGKYIGGGMSFGAFGGRADVMALFDPRTGPLAHSGTFNNN 304 RL+ G G+ DL+ GK IGGG+ GAFGG+A++M P GP+ +GT + N Sbjct: 245 FRLSLGGAQEYFGVTPDLSCFGKIIGGGLPVGAFGGKAEIMDHLAPE-GPVYQAGTLSGN 303 Query: 305 VMTMAAGYAGLTKLFTPEAAGALAERGEALRARLNALCANEGV--AMQFTGIGSLMNAHF 362 + MAAG A L +L P L + E L L G+ + F I S+ +F Sbjct: 304 PLAMAAGIATLKELQKPGVYQELRSKTEKLSEGLKEAAKAAGIYDKLHFKQIESISIVYF 363 Query: 363 VQGDVRSSEDLAAVDGRLRQLLFFHLLNEDIYSSPRGFVV--LSLPLTDADIDRYVAA 418 +V++ +D + + F +L + +Y +P F V +S T DI++ V A Sbjct: 364 TPKEVKNYQDALTSNTQAYAAFFRKMLQQGVYLAPSQFEVAFMSTAHTQEDIEKTVKA 421 Lambda K H 0.322 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 433 Length adjustment: 32 Effective length of query: 402 Effective length of database: 401 Effective search space: 161202 Effective search space used: 161202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory