Align cystathionine β-synthase (O-acetyl-L-serine) monomer (EC 4.2.1.22; EC 2.5.1.134; EC 2.5.1.47) (characterized)
to candidate WP_013553123.1 NITSA_RS00810 cysteine synthase A
Query= metacyc::HP_RS00545-MONOMER (306 letters) >NCBI__GCF_000186245.1:WP_013553123.1 Length = 303 Score = 249 bits (635), Expect = 7e-71 Identities = 133/309 (43%), Positives = 198/309 (64%), Gaps = 12/309 (3%) Query: 2 MIITTMQDAIGRTPVFKFTNKDYPIPLNSAIYAKLEHLNPGGSVKDRLGQYLIGEGFKTG 61 MI +Q IG+TP+ + + N+ I AK E+ NPG S+KDR+ + +I + G Sbjct: 1 MIFDDIQQTIGQTPLIRLAY----LSNNATILAKAEYFNPGSSIKDRVAKSMIDGAMERG 56 Query: 62 KITSKTTIIEPTAGNTGIALALVAIKHHLKTIFVVPEKFSTEKQQIMRALGALVINTPTS 121 ++ ++T +IEPT+GNTGI LALV L+ I +PE S E+++++R LGA ++ TP + Sbjct: 57 ELDAETVVIEPTSGNTGIGLALVCAVRGLRLILTMPESMSLERRKLLRHLGAELVLTPAA 116 Query: 122 EGISGAIKKSKELAESIPDSYLPLQFENPDNPAAYYHTLAPEIVQELGTNLTSFVAGIGS 181 EG+ GAI++++ LA S S++P QF NPDNPAA+ A EI++ G + FVA +G+ Sbjct: 117 EGMQGAIEEARRLAASFEKSFIPDQFANPDNPAAHERGTAQEILEATGGAVNIFVAAVGT 176 Query: 182 GGTFAGTARYLKERIPAIRLIGVEPEGS-ILNGGEPGPHEIEGIGVEFIPPFFENLDIDG 240 GGT +G R LK P +RL+ VEP S ++ GE GPH+I+GIG F+P +NLD+D Sbjct: 177 GGTLSGNGRALKAANPKLRLVAVEPAASPAISRGEAGPHKIQGIGAGFVP---DNLDLDL 233 Query: 241 FE---TISDEEGFSYTRKLAKKNGLLVGSSSGAAFVAALKEAQRLP-EGSQVLTIFPDVA 296 + T++DEE ++ R+ A+K GLLVG SSGA AA + AQR G ++T+ PD A Sbjct: 234 VDEVLTVTDEEAIAFAREAARKAGLLVGISSGANLAAAYRLAQREENRGKTIVTVLPDTA 293 Query: 297 DRYLSKGIY 305 +RYLS ++ Sbjct: 294 ERYLSTELF 302 Lambda K H 0.316 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 303 Length adjustment: 27 Effective length of query: 279 Effective length of database: 276 Effective search space: 77004 Effective search space used: 77004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory