Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (characterized)
to candidate WP_013553775.1 NITSA_RS04170 amidohydrolase
Query= SwissProt::D5E0A1 (375 letters) >NCBI__GCF_000186245.1:WP_013553775.1 Length = 404 Score = 184 bits (466), Expect = 5e-51 Identities = 119/377 (31%), Positives = 191/377 (50%), Gaps = 19/377 (5%) Query: 3 ENEFVKIRRELHKIPELGFQEVKTQRFLLDYINTLPQERLEVKTWKT--GLFVKVHGTNP 60 + V+IR E+H+ PEL +E +T + + L E + KT++ GL + Sbjct: 15 DERVVQIRHEIHQNPELSGEEKETNLLIR---SILEAEGIPFKTFEGHYGLVADIIKDPS 71 Query: 61 TKTIGYRADIDGLPITEETNYSFQSQHEGLMHACGHDMHMAIGLGVLTYF--AQHEIKDN 118 T+ R D+D LP+ E ++ S+ S+ +G+MHACGHD H +I LGV + ++ N Sbjct: 72 LPTVAIRGDMDALPMPENSDKSYASKKKGIMHACGHDAHTSIALGVALALNRLKEKLPGN 131 Query: 119 VLFIFQPAEEGPGGAQPMLQSDIMKEWLPDFIFALHVAPEYPVGSIALKEGLLFANTSEL 178 V IFQP+EE G + +D E + IF LHV P G I K G++ A+ Sbjct: 132 VRIIFQPSEEVLEGGSEQMIADGALEGV-SAIFGLHVYPYLHTGQIGYKYGVMMASADTF 190 Query: 179 FIDLKGKGGHAAYPHTTNDMVVAACQLVSQLQTIVARNVDPLDSAVITVGKIQGGTVQNI 238 D+ GK H A PH D V+ A +++ L IV+R +DP+ AVI++GKI+GG NI Sbjct: 191 SFDIYGKTAHGARPHEGIDAVLVAAMVINSLNHIVSRRIDPIHPAVISMGKIEGGNAPNI 250 Query: 239 IAERARIEGTIRTLSPESMTRVKERIEAIVKGVEVGYQCETAIDYGCMYHQVYNHHEVTR 298 I + + GT+RT++ ++ E +E +KG+ + Y ++ N+ + Sbjct: 251 ICDFVTVAGTVRTVNASVRKKIPEMMETTIKGICAAMDAKYHFRYEFGPPELTNNDHMVD 310 Query: 299 EFMEFAKEQTD----VDVIECKEAMTGEDFGYMLKDIPGFMFWLGVQSE-----YGLHHA 349 E A+E VD+++ M GEDF L+ IPG F LGV +E H+ Sbjct: 311 IVKEAAEEVVGKEGLVDLVD--PVMGGEDFSRYLQIIPGAFFRLGVCNEEKGTCVPQHNT 368 Query: 350 KLQPHEGAIDIAISLIT 366 + + A+ I + +++ Sbjct: 369 RFDVDDDALAIGMKILS 385 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 404 Length adjustment: 30 Effective length of query: 345 Effective length of database: 374 Effective search space: 129030 Effective search space used: 129030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory