Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate WP_013644774.1 METBO_RS05910 cysteine synthase A
Query= BRENDA::P9WP53 (323 letters) >NCBI__GCF_000191585.1:WP_013644774.1 Length = 328 Score = 185 bits (470), Expect = 1e-51 Identities = 116/306 (37%), Positives = 166/306 (54%), Gaps = 17/306 (5%) Query: 5 DSLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEA 64 + + + +GNTPLV L +L+ +G + K+E NP S+KDR V MIE E Sbjct: 13 NDITETIGNTPLVRLNKLT-------EGSKAEVLVKVESFNPLSSVKDRIGVAMIEAGEE 65 Query: 65 DGLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSA 124 G+++ ++EPTSGNTGI+LA A KGY+LI MP+ S+ERR+LL L GA+I+ + Sbjct: 66 AGVIKENTILIEPTSGNTGIALAFVAAAKGYKLILTMPDTMSIERRKLLALLGAEIVLTP 125 Query: 125 AEGGSNTAVATAKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLP-EITHFVAGL 183 G AVA A+ELAA P VM Q+ N AN H T E+ D ++ V+G Sbjct: 126 GANGMPGAVAKAEELAAEIPGAVMPQQFKNIANPKIHRETTAQEIWRDTDGKVDVLVSGT 185 Query: 184 GTTGTLMGTGRFLREHVANVKIVAAEP-------RYGEGVYALRNMDEGFVPELYDPEIL 236 GT GT+ G L+E K VA EP G + ++ + GF+P++ EI+ Sbjct: 186 GTGGTITGVATALKELKPEFKAVAVEPVTSPVLSGGSPGPHKIQGIGPGFIPDVLQTEII 245 Query: 237 TARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVADA 296 V DA + +L EGI AGIS+GA + AAL + AG++ I +++ D Sbjct: 246 DEIVQVSDDDAAQTLLKLAREEGILAGISSGAAVFAALQLAKKDEYAGKQ--IVVILPDT 303 Query: 297 GWKYLS 302 G +YLS Sbjct: 304 GERYLS 309 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 328 Length adjustment: 28 Effective length of query: 295 Effective length of database: 300 Effective search space: 88500 Effective search space used: 88500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory