Align O-phosphoserine sulfhydrylase monomer (EC 2.5.1.47; EC 2.5.1.65) (characterized)
to candidate WP_013644774.1 METBO_RS05910 cysteine synthase A
Query= metacyc::MONOMER-20568 (299 letters) >NCBI__GCF_000191585.1:WP_013644774.1 Length = 328 Score = 226 bits (577), Expect = 4e-64 Identities = 126/300 (42%), Positives = 173/300 (57%), Gaps = 10/300 (3%) Query: 2 IYDNILETIGNTPLVRINHLNPNPKVQMYAKLEGFNPTGSVKDRIALKMIEQAEAEGKLH 61 I ++I ETIGNTPLVR+N L K ++ K+E FNP SVKDRI + MIE E G + Sbjct: 11 IANDITETIGNTPLVRLNKLTEGSKAEVLVKVESFNPLSSVKDRIGVAMIEAGEEAGVIK 70 Query: 62 PGSTIIEATSGNTGIGLAMIGRVKGYNVIIVMSEGVSIERRKMIKAFGAEIILTDKKLGT 121 + +IE TSGNTGI LA + KGY +I+ M + +SIERRK++ GAEI+LT G Sbjct: 71 ENTILIEPTSGNTGIALAFVAAAKGYKLILTMPDTMSIERRKLLALLGAEIVLTPGANGM 130 Query: 122 DGAIRKVAELVKENPGKYFNPNQFSNEYNKIAHYKTTAEEIWAQTKGTVTHFVAAVGTSG 181 GA+ K EL E PG P QF N N H +TTA+EIW T G V V+ GT G Sbjct: 131 PGAVAKAEELAAEIPGAVM-PQQFKNIANPKIHRETTAQEIWRDTDGKVDVLVSGTGTGG 189 Query: 182 TLMGVGKNLREKNPEIKIIEAQPTKGHYIQG-------LKSMEEAIVPAIYQADKIDEHI 234 T+ GV L+E PE K + +P + G ++ + +P + Q + IDE + Sbjct: 190 TITGVATALKELKPEFKAVAVEPVTSPVLSGGSPGPHKIQGIGPGFIPDVLQTEIIDEIV 249 Query: 235 LIESEEAFAKAREIVAQEGIFIGMSSGAAMLAAQKLAEKID--SGVIVVLFADRGEKYLS 292 + ++A ++ +EGI G+SSGAA+ AA +LA+K + IVV+ D GE+YLS Sbjct: 250 QVSDDDAAQTLLKLAREEGILAGISSGAAVFAALQLAKKDEYAGKQIVVILPDTGERYLS 309 Lambda K H 0.315 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 328 Length adjustment: 27 Effective length of query: 272 Effective length of database: 301 Effective search space: 81872 Effective search space used: 81872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory