Align asparagine-oxo-acid transaminase (EC 2.6.1.14); alanine-glyoxylate transaminase (EC 2.6.1.44); serine-glyoxylate transaminase (EC 2.6.1.45) (characterized)
to candidate WP_013706246.1 DESAC_RS06350 alanine--glyoxylate aminotransferase family protein
Query= BRENDA::Q56YA5 (401 letters) >NCBI__GCF_000195295.1:WP_013706246.1 Length = 381 Score = 229 bits (584), Expect = 1e-64 Identities = 134/382 (35%), Positives = 207/382 (54%), Gaps = 7/382 (1%) Query: 9 RHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFLFPTT 68 +H+L PGP + + AM +RSP + +K +F+T + +T Sbjct: 3 KHYLLAPGPTPVSPETLLAMATPIIHHRSPQFAEVVAECRVGLKYLFQTKQEV-LILAST 61 Query: 69 GTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLAS 128 GTGA E A+TNTLSPGD + G+F W + N + ++ +WG+ + +A+ Sbjct: 62 GTGAMEGAITNTLSPGDTALVVRGGKFGERWGEICAAYGVNFEAIDVEWGRAVQVADVAA 121 Query: 129 KLSQDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMD 188 KL N IKA+CI +ET+TGV + + + L LLLVD +S++ A + MD Sbjct: 122 KLKA--NPAIKAVCIQAHETSTGVNHPVKELAELTKSLPG-TLLLVDAISALGAFELPMD 178 Query: 189 EWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWP 248 WG+D+ + GSQKA+ LP GL C S KA E TKT+ K +F+++ LK + T Sbjct: 179 AWGIDIMVAGSQKAMMLPPGLAFACLSEKAWEFTKTATCNKYYFNFSKELKNIQKNT-GA 237 Query: 249 YTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNTV 308 YT ++ L+ GLR L E LE I A H + KAT+ AV+A GL+ +Q E S+ + Sbjct: 238 YTSAVSLVMGLRDVLRYFKEATLEKIFAEHQLMSKATKAAVKALGLELFSQ--EGASDAL 295 Query: 309 TAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLAGVEM 368 TAV P +DG ++V+ +Y + + G + GK+FRI H+G + ++ +A +E+ Sbjct: 296 TAVRAPAGVDGQDVVKLLRDKYGIMIAGGQAEAKGKIFRIAHMGYIGNFDIVMIIAALEV 355 Query: 369 ILKDVGYPVVMGSGVAAASTYL 390 +L ++GY G+GV AA L Sbjct: 356 VLNELGYKAPYGAGVKAAEEVL 377 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 381 Length adjustment: 31 Effective length of query: 370 Effective length of database: 350 Effective search space: 129500 Effective search space used: 129500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory