Align [amino group carrier protein]-C-terminal-L-glutamyl-γ-L-lysine aminotransferase (EC 2.6.1.118; EC 2.6.1.124) (characterized)
to candidate WP_011320429.1 AVA_RS18905 aspartate aminotransferase family protein
Query= metacyc::MONOMER-18314 (387 letters) >NCBI__GCF_000204075.1:WP_011320429.1 Length = 427 Score = 249 bits (635), Expect = 1e-70 Identities = 138/396 (34%), Positives = 220/396 (55%), Gaps = 21/396 (5%) Query: 3 LIQLYGDRGLTIVKGEAQYVWDIEGRRYLDFHTGIGVAFLGHRNPIILEYLKNQLENISI 62 ++ YG L + +G VWD +GR YLDF GI LGH +P ++E + Q++ + Sbjct: 33 VMSTYGRFPLALERGAGCRVWDTQGREYLDFVAGIATCTLGHAHPAMVEAVTRQIQKLHH 92 Query: 63 LSTSFSTPIKDEMLQALDKVKPDKMDNAMLLNSGTEAVEAALKTARKITG-----RKKII 117 +S + P + E+ Q + ++ D NSG EA EAA+K ARK K II Sbjct: 93 VSNLYYIPEQGELAQWI--IQHSCADRVFFCNSGAEANEAAIKLARKYAHTVLDIEKPII 150 Query: 118 AFKNA-FHGRTAGSLSVTWNKKYREPFEPLVGPVEFLTFNNIE-------DLSKIDNETA 169 NA FHGRT +++ T KY++ F+PLV ++ +N+I +L + D A Sbjct: 151 LTANASFHGRTLATITATGQAKYQKYFDPLVPGFHYVNYNDISAVEAAISELDEGDYRVA 210 Query: 170 AVIVEPIQGESGVIPANIEFMKALKEKTENTGSLLIFDEIQTGFGRTGKLWAYKHYNIVP 229 A+++EP+QGE GV P ++E+ + L++ ++TG LL+FDE+Q G GR+GKLW Y++ + P Sbjct: 211 AILIEPLQGEGGVRPGDVEYFQKLRQICDDTGILLMFDEVQVGMGRSGKLWGYEYLGVEP 270 Query: 230 DILTAGKAIGGGFPVSVVFLPDHIANKLEEGDHGSTYGGNPMAMAAVTAACKVIEKENVV 289 DI T+ K +GGG P+ + + + + G+H ST+GGNP A A C+ +E+EN++ Sbjct: 271 DIFTSAKGLGGGIPIGAM-MSKKFCDVFQPGEHASTFGGNPFACGVALAVCQTLERENIL 329 Query: 290 EQANQKGQQFSNILVKNLADL-KVVREVRGKGLMIGI----DIRFQPGQVLKYLQEKGIL 344 + +G+Q L A + EVRG GL+ G+ DI+ V+K +G+L Sbjct: 330 QNVEDRGEQLRAGLRALAAKYPHHLTEVRGWGLINGLELAADIQLTAADVVKAAINEGLL 389 Query: 345 AVKAGSTVIRFLPSYLITYENMEEASNVLREGLLKI 380 V AG V+RF+P ++T + A +L + L + Sbjct: 390 LVPAGPKVVRFVPPLIVTEAEINTALKLLEKALATV 425 Lambda K H 0.317 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 427 Length adjustment: 31 Effective length of query: 356 Effective length of database: 396 Effective search space: 140976 Effective search space used: 140976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory