Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54); chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_104009967.1 AVA_RS20175 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::P39912 (358 letters) >NCBI__GCF_000204075.1:WP_104009967.1 Length = 362 Score = 244 bits (622), Expect = 3e-69 Identities = 131/298 (43%), Positives = 189/298 (63%), Gaps = 17/298 (5%) Query: 62 NDGPFENSTIQHIFKEIFKAGLELQEEDHSKALLVSRKKKPEDTIVDIKGEKIGDGQQRF 121 N PF I+ I K +A LE + +HS + +V I GQ Sbjct: 55 NLNPFIEQVIR-IKKPFKRASLEFRYGEHS------------EVVVPTPNGPITFGQNHP 101 Query: 122 IV---GPCAVESYEQVAEVAAAAKKQGIKILRGGAFKPRTSPYDFQGLGVEGLQILKRVA 178 +V GPC+VE+ E + E A A K+ G + LRGGA+KPRTSPY FQG G L +L + Sbjct: 102 VVVVAGPCSVENEEMIVETAQAVKEYGAQFLRGGAYKPRTSPYAFQGHGESALALLAKAK 161 Query: 179 DEFDLAVISEIVTPAHIEEALDYIDVIQIGARNMQNFELLKAAGAVKKPVLLKRGLAATI 238 + L +I+EI+ +++ ++ DV+QIGARNMQNF LLK GA KPVLLKRGL+ATI Sbjct: 162 EATGLGIITEIMDADDLDKLIEVADVLQIGARNMQNFSLLKKIGATTKPVLLKRGLSATI 221 Query: 239 SEFINAAEYIMSQGNDQIILCERGIRTYETA-TRNTLDISAVPILKQETHLPVFVDVTHS 297 +++ +AEYI++ GN +ILCERGIRT++ TRNTLDISA+P+L+ THLP+ +D +H+ Sbjct: 222 EDWLMSAEYILAGGNPNVILCERGIRTFDRQFTRNTLDISAIPVLRTLTHLPIMIDPSHA 281 Query: 298 TGRRDLLLPTAKAALAIGADGVMAEVHPDPSVALSDSAQQMAIPEFEKWLNELKPMVK 355 TG+ + + A++A GAD +M EVHP+P+ ALSD Q + + F++ ++E+ + K Sbjct: 282 TGKSEFVPTMTMASIAAGADSLMIEVHPNPAKALSDGPQSLTLEGFKELMHEITALSK 339 Lambda K H 0.316 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 362 Length adjustment: 29 Effective length of query: 329 Effective length of database: 333 Effective search space: 109557 Effective search space used: 109557 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory