Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate WP_011321547.1 AVA_RS24820 anthranilate synthase
Query= curated2:P14953 (494 letters) >NCBI__GCF_000204075.1:WP_011321547.1 Length = 728 Score = 224 bits (571), Expect = 8e-63 Identities = 144/401 (35%), Positives = 211/401 (52%), Gaps = 24/401 (5%) Query: 87 QREVEGNPVEIIKGIMGKFKGANLPNLPRFNGGAVGYFGYDLIRHYENLPNVPEDDMGLP 146 QR + + +I+ I+ F +L G G FGYDL+ +E +P Sbjct: 126 QRSKQPSAFTVIREILQIFASDEDEHL-----GLYGAFGYDLVFQFEPIPQKIARPADQR 180 Query: 147 ECHFMFTDEVLVYDHLKQKIHIIVNLHVNGNIERAYISAVDRIKTIHREILDTRWKTADN 206 + DE++V D+ QK + Y A + T H +T + Sbjct: 181 DLVLYLPDELIVVDYYLQKAY-----------RHQYEFATEHGNTEHLP------RTGQS 223 Query: 207 SVLSYNKKKNELAVTSNISKEDFCRNVLKAKQYIRDGDIFQVVLSQRLCVETNENPFNIY 266 + Y K+ T++ ++ V +A Y R GD+F+VV SQ ++P ++ Sbjct: 224 --IDYQGKRLLPNQTADHQPGEYANLVEQALDYFRRGDLFEVVPSQNFFTACEQSPSQLF 281 Query: 267 RALRVINPSPYMYYLKFGGYRIIGSSPEMLVRVENGIVETCPIAGTRKRGRTKEEDEALE 326 + LR INPSPY + L GG +IG+SPEM VRV+ VETCPI+GT +RG D Sbjct: 282 QTLRQINPSPYGFLLNLGGEYLIGASPEMFVRVDGRRVETCPISGTIRRGEDALGDAVQI 341 Query: 327 KELLSDEKEIAEHVMLVDLGRNDIGRVSKFGTVAVKNLMHIERYSHVMHVVTNVQGEIRE 386 ++LL+ K+ AE M D+ RND R+ + G+V V IE YSH++H V +V+G +R Sbjct: 342 RQLLNSHKDEAELTMCTDVDRNDKSRICEPGSVRVIGRRQIELYSHLIHTVDHVEGILRP 401 Query: 387 DKTPFDALMSILPAGTLSGAPKVRAMEIIDELETVKRGPYGGAIGYLSFNGNLDSCITIR 446 + DA +S A T++GAPK AM+ I++ E R YGGA+GYL FNGNL++ +T+R Sbjct: 402 EFDALDAFLSHTWAVTVTGAPKRAAMQFIEQHERSARRWYGGAVGYLGFNGNLNTGLTLR 461 Query: 447 TIILKDGKAYVQAGAGIVADSVPEREYEECYNKAMALLKAI 487 TI L+D A V+ GA ++ DSVP E EE KA AL + I Sbjct: 462 TIRLQDSIAEVRVGATVLYDSVPSAEEEETITKATALFETI 502 Lambda K H 0.319 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 742 Number of extensions: 38 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 494 Length of database: 728 Length adjustment: 37 Effective length of query: 457 Effective length of database: 691 Effective search space: 315787 Effective search space used: 315787 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory