Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate WP_013820662.1 METME_RS20555 succinyldiaminopimelate transaminase
Query= BRENDA::O66630 (387 letters) >NCBI__GCF_000214665.1:WP_013820662.1 Length = 400 Score = 178 bits (452), Expect = 2e-49 Identities = 129/394 (32%), Positives = 199/394 (50%), Gaps = 24/394 (6%) Query: 8 LKVLPPYLFAELDRKKQEKIEQGVDV-IDLGVGDPDMPTPKPIVEAAKKALENPENHKYP 66 L++L PY F +L KQ I L +G+P TP I EA + L+ +YP Sbjct: 5 LQLLHPYPFEKLAELKQGITPPAHKAHIALSIGEPKHATPAFIQEALVRHLQGLT--QYP 62 Query: 67 SYVGKYEFRKAVADWYKRRFDVD---LDPNTEVITLIGSKEGIAHFPLAFVNPGD--IVL 121 + G E R+A+ADW RRF + +D +T+V+ + G++E + A V+P + +V+ Sbjct: 63 TTKGLPELRQAIADWIGRRFAIPAEHIDADTQVMPVNGTREALFAIVQAVVDPREKPVVI 122 Query: 122 CPDPAYPVYRIGAIFAGGTPYTVPLKEENNFLPDLDSIPEDVAKKAKIIWINYPNNPTSA 181 P+P Y +Y A+ AG PY + E + +LPD +S+PE + ++ ++I+I P NPT Sbjct: 123 MPNPFYQIYEGAALLAGAEPYYLNTLEADGYLPDFNSVPEAIWQRCQLIFICSPGNPTGT 182 Query: 182 PPTLEFYKKLVDWAKEYNVIIASDNAYSEIYTGQEKPP-SILQ---VPGAKDV--AIEFH 235 + ++KL++ A YN +IASD Y+E+Y + PP +LQ G D + F Sbjct: 183 VMSQADHEKLLELATRYNFVIASDECYTELYDDEALPPRGLLQSAYQAGMIDFKNCVIFQ 242 Query: 236 SLSKTYNMTGWRIGMAVGNKELVAGLGKVKTNVDSGQFGAVQDAGIVALNLPEEEVEKIR 295 SLSK N G R G G+ E++ K +T Q A I A E V++ R Sbjct: 243 SLSKRSNAPGLRSGFVAGDAEILRQFLKYRTYHGCPMPVTTQHASIAAWR-DEAHVQQNR 301 Query: 296 DVYRERKKIMTEALEKIGLEIYRSDYTFYLWIKVPEGYTSAEFVGRLIDEAGIVCTPG-- 353 +YR++ E L+ + EI R +FY+W+K EF +L + I PG Sbjct: 302 QLYRDKFTAFIEILQDV-CEISRPPASFYIWLKT--ALPDTEFALQLFAQQNITVLPGSY 358 Query: 354 ----NGFGEYGEGYFRISLTVPTERLLEAAERIK 383 +G G + RI+L P E +EAA+RIK Sbjct: 359 LSRDSGGINPGANHVRIALVAPLEECVEAAQRIK 392 Lambda K H 0.317 0.139 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 400 Length adjustment: 31 Effective length of query: 356 Effective length of database: 369 Effective search space: 131364 Effective search space used: 131364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory