Align Aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79 (characterized)
to candidate WP_013819219.1 METME_RS13060 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::Q82WA8 (397 letters) >NCBI__GCF_000214665.1:WP_013819219.1 Length = 393 Score = 489 bits (1258), Expect = e-143 Identities = 243/390 (62%), Positives = 305/390 (78%), Gaps = 5/390 (1%) Query: 3 LSQRVQAIKPSPTLAVTAKAARLKAEGKNIIGLGAGEPDFDTPLHIKDAAITAIRNGFTK 62 LS RV+A+KPSPTLA+TA+AA ++A GK+IIGLGAGEPDFDTP HIK +A+ A+ NGFTK Sbjct: 5 LSNRVKAVKPSPTLAITARAAAMRAAGKDIIGLGAGEPDFDTPDHIKASAVKALDNGFTK 64 Query: 63 YTAVGGTASLKQAIISKFKRENSLEFMPGEILVSSGGKQSFFNLVLATIDPGDEVIIPAP 122 YTAV G SLK+AI KFK +N L++ +ILVSSGGKQSF+NL A ++PGDEVIIPAP Sbjct: 65 YTAVDGIPSLKKAIAQKFKNDNGLDYQSKQILVSSGGKQSFYNLAQALLNPGDEVIIPAP 124 Query: 123 YWVSYPDIVLIAEGKPVFIDTGIEEKFKISPDQLEKAITPRTRMFVVNSPSNPSGSVYSL 182 YWVSYPD+VL+A+G PV ++ G + FKI+P QL AIT +TR+FV+NSPSNP+G+ YSL Sbjct: 125 YWVSYPDMVLLADGVPVIVEAGQSQNFKITPAQLRAAITDKTRLFVINSPSNPTGAAYSL 184 Query: 183 EELQALGAVLRKYPDILIATDDMYEHILLSGDGFVNILNACPDLKARTVVLNGVSKAYAM 242 +EL+ALG VL+ +P++LIATDDMYEHIL + FVNILNA PD RT+VLNGVSKAY+M Sbjct: 185 DELKALGEVLQDFPEVLIATDDMYEHILWNKGEFVNILNARPDFYPRTIVLNGVSKAYSM 244 Query: 243 TGWRIGYCGGPAAIITAMENIQSQSTSNPNSIAQVAAEAALNGDQSCMVPMIEAFRERNQ 302 TGWRIGYC GPA +I AM IQSQSTSNP SI+QVAAE AL GDQSC+ M+ F++R+ Sbjct: 245 TGWRIGYCAGPANLIEAMCIIQSQSTSNPTSISQVAAETALTGDQSCIDTMMVEFKKRHD 304 Query: 303 FLTNALNSIAGIHCLLSEGAFYAFVDVRQAISRLNTQQILQNSSDIAFCNYVLEKAEVAA 362 F+ LN+I GI CL ++G FY F +V + I++L D+ F Y++EKA VA Sbjct: 305 FVVAELNNIDGIECLATDGTFYVFPNVEKLINKLE-----GIDDDLQFAEYLIEKAGVAL 359 Query: 363 VPGSAFGCEGYMRLSFATSMDNLQEAVKRI 392 VPGSAFGC G++R+S ATSM NL+ A+ RI Sbjct: 360 VPGSAFGCPGHIRISIATSMANLENALARI 389 Lambda K H 0.318 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 393 Length adjustment: 31 Effective length of query: 366 Effective length of database: 362 Effective search space: 132492 Effective search space used: 132492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory