Align Prephenate dehydrogenase protein; EC 1.3.1.12 (characterized, see rationale)
to candidate WP_013818547.1 METME_RS09460 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= uniprot:D8IR44_HERSS (295 letters) >NCBI__GCF_000214665.1:WP_013818547.1 Length = 292 Score = 225 bits (573), Expect = 1e-63 Identities = 117/286 (40%), Positives = 172/286 (60%), Gaps = 3/286 (1%) Query: 1 MFKKVVIFGVGLIGGSFALALRRAGQAAHIVGVG---RSLQSLERARELGIIDAVATDAA 57 MFK++ + G GLIGGS A A R G IV G ++L +L+ A++LG+ID TD Sbjct: 1 MFKRLCVIGTGLIGGSIARAARAQGLCEEIVAFGGREKNLPNLQLAQQLGVIDRFYTDMG 60 Query: 58 SAVQGADLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQF 117 A+ ADL++VA PV I I PH PQA+ +DAGSTK VVAA A G F Sbjct: 61 QALAEADLVIVATPVGSMRNIFELIKPHWHPQALYSDAGSTKGSVVAAVEAAFGHVPNNF 120 Query: 118 IPAHPIAGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQ 177 +PAHPIAG E+ G +A+ A+L++ ++++IT L D VE ++ WR G+ + +S + Sbjct: 121 VPAHPIAGAERSGVDASQADLFKNRRLIITPLENTDRQFVEKLSNFWRQIGSSVSLMSVE 180 Query: 178 EHDAVFASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITL 237 HD V A+ SHLPH+LAF LV + K +F+YAA GF+DF+RIA+S P MW+DI L Sbjct: 181 HHDTVLAATSHLPHILAFTLVGLLGRKDEQREIFKYAAGGFKDFSRIASSDPTMWQDICL 240 Query: 238 ANRDALLTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQQW 283 AN+ ++ + + +L +I ++ + + A+ ARQ++ Sbjct: 241 ANKREIIPLIQQFKAELSHIEQLLTNDQAEQLFDTFTYARDARQRF 286 Lambda K H 0.320 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 292 Length adjustment: 26 Effective length of query: 269 Effective length of database: 266 Effective search space: 71554 Effective search space used: 71554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory