Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_013835577.1 THICY_RS05275 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::C3TIE2 (350 letters) >NCBI__GCF_000214825.1:WP_013835577.1 Length = 355 Score = 423 bits (1088), Expect = e-123 Identities = 212/348 (60%), Positives = 262/348 (75%), Gaps = 1/348 (0%) Query: 3 YQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCS 62 +Q DDLRI I E+ PP+AL EKFP T+ AA TV R+AI IL G+DDRLLVVIGPCS Sbjct: 4 FQTDDLRINHITEVQPPIALHEKFPITDTAATTVFKTRQAIKAILNGDDDRLLVVIGPCS 63 Query: 63 IHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDG 122 IHD A YA +L ++ ++L IVMRVYFEKPRTTVGWKGLINDP ++ +F+IN G Sbjct: 64 IHDTQAGLAYAEKLATQIDKYANDLLIVMRVYFEKPRTTVGWKGLINDPDLNETFKINKG 123 Query: 123 LRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCP 182 L AR LL++N G+PAA EFLD+I+PQY++DL+SWGAIGARTTESQ HRELASGLSCP Sbjct: 124 LEKARGFLLNVNSLGVPAATEFLDLISPQYISDLVSWGAIGARTTESQGHRELASGLSCP 183 Query: 183 VGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKE-PNY 241 VGFKNGTDG KVA+DAI AA PH F+S+TK GHSAI +T+GN DCH+ILRGG + PNY Sbjct: 184 VGFKNGTDGGFKVAVDAIRAANRPHIFMSLTKQGHSAIFSTTGNEDCHVILRGGNDGPNY 243 Query: 242 SAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVMV 301 + V + + L KAG+ ++MID SHANSSK KQM+V + +Q+A G I+G MV Sbjct: 244 AHPFVEQAVQELQKAGVQPKLMIDCSHANSSKDHLKQMEVARSINEQLANGSPYIMGAMV 303 Query: 302 ESHLVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARR 349 ESHLV G Q + SG+ L +G+SITDACI W ++ LL LA+ V++RR Sbjct: 304 ESHLVAGRQDVISGQSLTFGQSITDACIDWPMSETLLEMLADGVRSRR 351 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 355 Length adjustment: 29 Effective length of query: 321 Effective length of database: 326 Effective search space: 104646 Effective search space used: 104646 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_013835577.1 THICY_RS05275 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.2705287.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-162 524.3 0.0 6.3e-162 524.1 0.0 1.0 1 NCBI__GCF_000214825.1:WP_013835577.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000214825.1:WP_013835577.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 524.1 0.0 6.3e-162 6.3e-162 1 342 [] 7 351 .. 7 351 .. 0.99 Alignments for each domain: == domain 1 score: 524.1 bits; conditional E-value: 6.3e-162 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkk 73 ddlri +i e+ +P +l++kfp+t +aa++v k+r++i+ il+G+ddrllvviGPcsihd +a l ya++l++ NCBI__GCF_000214825.1:WP_013835577.1 7 DDLRINHITEVQPPIALHEKFPITDTAATTVFKTRQAIKAILNGDDDRLLVVIGPCSIHDTQAGLAYAEKLAT 79 799********************************************************************** PP TIGR00034 74 laeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispq 146 +k+ +dl ivmrvyfekPrttvGWkGlindPdlne+f++nkGl+ ar +ll+++ lg+p+ate+ld ispq NCBI__GCF_000214825.1:WP_013835577.1 80 QIDKYANDLLIVMRVYFEKPRTTVGWKGLINDPDLNETFKINKGLEKARGFLLNVNSLGVPAATEFLDLISPQ 152 ************************************************************************* PP TIGR00034 147 yladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetk 219 y++dl+swgaiGarttesq hrelasgls+pvgfkngtdG+ kva+dairaa+++h+f+s tk+G++ai +t+ NCBI__GCF_000214825.1:WP_013835577.1 153 YISDLVSWGAIGARTTESQGHRELASGLSCPVGFKNGTDGGFKVAVDAIRAANRPHIFMSLTKQGHSAIFSTT 225 ************************************************************************* PP TIGR00034 220 GnedghiilrGGkk.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekai 291 Gned+h+ilrGG++ pny v+++ +el+kag +++lmid+sh+ns+kd+ +q+eva+s+ eq+a+G+ i NCBI__GCF_000214825.1:WP_013835577.1 226 GNEDCHVILRGGNDgPNYAHPFVEQAVQELQKAGVQPKLMIDCSHANSSKDHLKQMEVARSINEQLANGSPYI 298 ************************************************************************* PP TIGR00034 292 iGvmiesnleeGnqsl..keelkyGksvtdacigwedteallrklaeavkerr 342 +G m+es+l+ G+q++ +++l++G+s+tdaci+w ++e+ll+ la+ v++rr NCBI__GCF_000214825.1:WP_013835577.1 299 MGAMVESHLVAGRQDVisGQSLTFGQSITDACIDWPMSETLLEMLADGVRSRR 351 ***************988899*****************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (355 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 22.34 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory