Align Aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.78 (characterized)
to candidate WP_013835367.1 THICY_RS04220 histidinol-phosphate transaminase
Query= SwissProt::Q8KDS8 (400 letters) >NCBI__GCF_000214825.1:WP_013835367.1 Length = 363 Score = 84.0 bits (206), Expect = 7e-21 Identities = 63/197 (31%), Positives = 99/197 (50%), Gaps = 8/197 (4%) Query: 99 EIIVSNGGKQALANTFLALCDEGDEVIVPAPYWVSFPEMARLAEATPVIVETSIETGYKM 158 E++V NG + L GDEVI + + A++ ATP+ V Y Sbjct: 87 EVMVGNGSNELLEFVGRVFAGPGDEVIFSQYAFAVYAITAQIIGATPIQVTAK---AYGH 143 Query: 159 TPEQLAAAITPKTRILVLNSPSNPSGAVYNEAEVRALMQVIEGKEIFVLSDEMYDMICYG 218 + +AAAIT KT+++ L +P+NP+G+ ++ + A MQ + + V+ DE Y Sbjct: 144 DLDAMAAAITSKTKLIYLANPNNPTGSFFSADALTAFMQKVPA-NVVVVYDEAYLEYVER 202 Query: 219 GVRPFSPARIPEMKPWVIVSNGTSKSYSMTGWRIGYLAAPKWIINACDKIQSQTTSNANS 278 P S + + P VIV+ SK+Y + R+GYL A I+N ++I++ N N Sbjct: 203 DDAP-SGLALLDQYPNVIVTRTFSKAYGLAALRVGYLLAHPDIVNLLNRIRA--PFNVNE 259 Query: 279 IAQKAAVAALDGDQSIV 295 ++Q AVAAL DQ V Sbjct: 260 LSQVCAVAAL-ADQDFV 275 Lambda K H 0.316 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 363 Length adjustment: 30 Effective length of query: 370 Effective length of database: 333 Effective search space: 123210 Effective search space used: 123210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory