Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate WP_013840511.1 DESRU_RS02290 cysteine synthase family protein
Query= BRENDA::P9WP53 (323 letters) >NCBI__GCF_000215085.1:WP_013840511.1 Length = 293 Score = 224 bits (572), Expect = 2e-63 Identities = 128/300 (42%), Positives = 178/300 (59%), Gaps = 13/300 (4%) Query: 4 YDSLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAE 63 Y++LLQ +GNTP++ L S R+G ++L+AKLE NP GS+KDR A +IE AE Sbjct: 3 YENLLQIIGNTPVIRLNSYS------REG--LKLYAKLEGNNPGGSVKDRTAKYLIESAE 54 Query: 64 ADGLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFS 123 G L +LE TSGNTGI+LAM A KGYR VMPEN SVER +LL+ YGA+++ + Sbjct: 55 RQGQLHKDRILLEATSGNTGIALAMIAATKGYRFTAVMPENASVERIKLLKAYGAELVLT 114 Query: 124 AAEGGSNTAVATAKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLPEITHFVAGL 183 G+N A+ A+++ +P + M Q+ NPAN +HY TG E++ LP +T VAG+ Sbjct: 115 DGGKGTNGAIEVARQMLEQDPRYYMPDQFSNPANPRAHYETTGKEVIDALPGVTALVAGI 174 Query: 184 GTTGTLMGTGRFLREHVANVKIVAAEPRYGEGVYALRNMDEGFVPELYDPEILTARYSVG 243 GT GT+ GTG+ L+ + + IVA EP G + LRNM + + P +YD ++ + V Sbjct: 175 GTGGTISGTGKRLKAYNPAIDIVAVEPAAGSRIQGLRNM-QAYKPPVYDDSVVDYKLDVP 233 Query: 244 AVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVADAGWKYLST 303 +A + REL EG+ GIS GA L AL G + I ++ D G KY ST Sbjct: 234 DQEAFKLARELYTKEGLAVGISCGAALWGALQYGKNL----QEGTIVMIFPDRGDKYFST 289 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 293 Length adjustment: 27 Effective length of query: 296 Effective length of database: 266 Effective search space: 78736 Effective search space used: 78736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory