Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_005457568.1 SACCYDRAFT_RS15720 ornithine--oxo-acid transaminase
Query= BRENDA::O30508 (406 letters) >NCBI__GCF_000244975.1:WP_005457568.1 Length = 411 Score = 239 bits (610), Expect = 1e-67 Identities = 143/392 (36%), Positives = 208/392 (53%), Gaps = 6/392 (1%) Query: 14 DRYMVPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQR 73 +R+ NY P + EG+ V D G +DF G + + GH HP LV+A EQ R Sbjct: 22 ERWSTHNYHPLPVVIAEAEGAWVTDVQGERYLDFLSGYSALNFGHRHPELVRAAVEQLGR 81 Query: 74 IWHVSNVFTNEPALRLARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYG--PQK 131 + S F ++ R+L + T E V NSGAEA E+A K+AR++A V G ++ Sbjct: 82 VTLTSRAFHHDQLGLFCRELAELTGTEMVLPMNSGAEAVESAIKVARKWAYRVKGVAEEQ 141 Query: 132 YEIIAASNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVV 191 +I+ A ++FHGRT V+ + FGP G VPY D AL A+++ T AV+ Sbjct: 142 AQIVVAGSNFHGRTTTIVSFSTDEQARADFGPFTPGFVVVPYGDAAALAQAVTEHTAAVL 201 Query: 192 LEPIQGEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDIL 251 LEPIQGE GV+ YL AR+LCDE ALL+ DE+QSG+ R G +FA H V D+ Sbjct: 202 LEPIQGEAGVVVPPDGYLAEARRLCDEAGALLIADEIQSGLARTGTIFALDHERVTADLY 261 Query: 252 SSAKSLGGG-FPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDG 310 + K+LGGG P+ A++ ++ L G HG+T+GGNPLA A+ A + +++T E Sbjct: 262 TLGKALGGGIMPVSAVVGRADVLGVLRPGEHGSTFGGNPLACALGRAVVRLLSTGEFQQR 321 Query: 311 VKAKHERFKSRLQKIGQEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQ 370 + R RL ++ G+ +RG GL G L + R+ A K V+ + Sbjct: 322 STSLGARLHERLSEL-LGNGV-AAVRGRGLWAGVDLAPDGL-TGREASEALMKRGVLCKE 378 Query: 371 ASPDVVRFAPSLVIDDAEIDEGLERFERAVAK 402 +R AP LVI +A++D G+ V + Sbjct: 379 THGHTLRLAPPLVISEADLDRGVAALAEVVGR 410 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 411 Length adjustment: 31 Effective length of query: 375 Effective length of database: 380 Effective search space: 142500 Effective search space used: 142500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory