Align O-phosphoserine sulfhydrylase monomer (EC 2.5.1.47; EC 2.5.1.65) (characterized)
to candidate WP_005458675.1 SACCYDRAFT_RS19045 cysteine synthase
Query= metacyc::MONOMER-20568 (299 letters) >NCBI__GCF_000244975.1:WP_005458675.1 Length = 316 Score = 243 bits (619), Expect = 5e-69 Identities = 128/295 (43%), Positives = 192/295 (65%), Gaps = 6/295 (2%) Query: 3 YDNILETIGNTPLVRINHLNPNPKVQMYAKLEGFNPTGSVKDRIALKMIEQAEAEGKLHP 62 Y ++L+ +G TPLV + L+P+P+V+++AKLE NPTGS+KDR AL MIE AE +G L Sbjct: 4 YASLLDALGGTPLVGLPRLSPSPEVRLWAKLEDRNPTGSIKDRPALAMIEAAERDGILKS 63 Query: 63 GSTIIEATSGNTGIGLAMIGRVKGYNVIIVMSEGVSIERRKMIKAFGAEIILTDKKLGTD 122 G TI+E TSGNTGI LAM ++KGY ++ VM E S ERR++++A+GA I+ + G++ Sbjct: 64 GDTILEPTSGNTGISLAMAAKLKGYGMVCVMPENTSEERRQLLQAYGARIVYSPAAGGSN 123 Query: 123 GAIRKVAELVKENPGKYFNPNQFSNEYNKIAHYKTTAEEIWAQTKGTVTHFVAAVGTSGT 182 A+R+ EL K NP + Q+ N N AHY T E+ + T+THFV +GT+GT Sbjct: 124 EAVRRAKELAKANP-DWVMLYQYGNPANADAHYYGTGPEL-LKDLPTLTHFVGGLGTTGT 181 Query: 183 LMGVGKNLREKNPEIKIIEAQPTKGHYIQGLKSMEEAIVPAIYQADKIDEHILIESEEAF 242 L+GVG+ LRE P++++I A+P G + GL++++E VP +Y + + + + +A Sbjct: 182 LVGVGRYLREHKPDVQVIAAEPRYGELVYGLRNLDEGFVPELYDPEVLSGRYSVGAYDAL 241 Query: 243 AKAREIVAQEGIFIGMSSGAAMLAAQKLAEKI----DSGVIVVLFADRGEKYLST 293 + RE++ +EGIF G+S+GA + AA +A K+ S I + AD G KYLST Sbjct: 242 RRTRELLEKEGIFAGISTGAVLHAALGVANKVLKKGGSADIAFVVADAGWKYLST 296 Lambda K H 0.315 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 316 Length adjustment: 27 Effective length of query: 272 Effective length of database: 289 Effective search space: 78608 Effective search space used: 78608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
Align candidate WP_005458675.1 SACCYDRAFT_RS19045 (cysteine synthase)
to HMM TIGR01136 (cysteine synthase (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01136.hmm # target sequence database: /tmp/gapView.2946509.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01136 [M=299] Accession: TIGR01136 Description: cysKM: cysteine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-109 352.3 0.0 1.4e-109 352.1 0.0 1.0 1 NCBI__GCF_000244975.1:WP_005458675.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000244975.1:WP_005458675.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 352.1 0.0 1.4e-109 1.4e-109 3 299 .] 9 299 .. 7 299 .. 0.97 Alignments for each domain: == domain 1 score: 352.1 bits; conditional E-value: 1.4e-109 TIGR01136 3 eliGntPlvrln.lseelkaevlvKlEsrnPsgSvKdRialsmildAekrgllkkgktiieatSGNtGiaLAm 74 +++G tPlv l ls++ ++++++KlE+rnP+gS+KdR+al+mi+ Ae++g lk g+ti+e+tSGNtGi+LAm NCBI__GCF_000244975.1:WP_005458675.1 9 DALGGTPLVGLPrLSPSPEVRLWAKLEDRNPTGSIKDRPALAMIEAAERDGILKSGDTILEPTSGNTGISLAM 81 789*********9************************************************************ PP TIGR01136 75 vaaakgyklilvmpetmslERrkllkayGaelvlteaeegmkgaiekakelaeeepekyvllkqfeNpaNpea 147 +a kgy +++vmpe++s+ERr+ll+ayGa++v ++a+ g++ a+++akela+++p +v+l q+ NpaN +a NCBI__GCF_000244975.1:WP_005458675.1 82 AAKLKGYGMVCVMPENTSEERRQLLQAYGARIVYSPAAGGSNEAVRRAKELAKANP-DWVMLYQYGNPANADA 153 ******************************************************98.899************* PP TIGR01136 148 HrkttgpEilkdtdgkidafvagvGtgGtitGvgrvlkekkpnvkivavePaespvlsegkpgphkiqgigag 220 H+ tgpE+lkd+ ++++fv g+Gt+Gt++Gvgr+l+e+kp+v+++a+eP+++++ ++g ++++++g NCBI__GCF_000244975.1:WP_005458675.1 154 HYYGTGPELLKDLP-TLTHFVGGLGTTGTLVGVGRYLREHKPDVQVIAAEPRYGEL-VYG------LRNLDEG 218 *************9.9***************************************9.677......9****** PP TIGR01136 221 fiPkildeelldevikvededaietarrlakeegilvGiSsGaavaaalkvakklek..edkkivvilpdage 291 f+P+++d e+l ++v + da++ +r+l ++egi++GiS+Ga+++aal va+k k +++i +++dag+ NCBI__GCF_000244975.1:WP_005458675.1 219 FVPELYDPEVLSGRYSVGAYDALRRTRELLEKEGIFAGISTGAVLHAALGVANKVLKkgGSADIAFVVADAGW 291 *****************************************************9887345689********** PP TIGR01136 292 rYLstelf 299 +YLst + NCBI__GCF_000244975.1:WP_005458675.1 292 KYLSTGAY 299 *****987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (316 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 19.58 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory