Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_014448518.1 LFE_RS01525 LL-diaminopimelate aminotransferase
Query= BRENDA::D2Z0I0 (402 letters) >NCBI__GCF_000284315.1:WP_014448518.1 Length = 395 Score = 293 bits (750), Expect = 6e-84 Identities = 150/379 (39%), Positives = 226/379 (59%), Gaps = 6/379 (1%) Query: 9 KVKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVANRPNVHGYS 68 ++K LP Y+FA ++E K + +G DI++LG+G+PD P I++ RP H Y Sbjct: 10 RIKSLPPYLFARIDEKKREAMAKGMDIINLGIGDPDTPTLPPIVEAARIALGRPEHHQYP 69 Query: 69 ASKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGDTVIVPNPT 128 + +G+ R++I +YK+R+ V+LDP + IG+KEG H+ LA ++PGDTV+VP P Sbjct: 70 SYEGMLSFRESIAHWYKKRFLVDLDPHTEVLGLIGSKEGIGHMPLAFIDPGDTVLVPEPG 129 Query: 129 YPIHYYAPIICGGDAISVPILPEEDFPEVFLRRLYDLIKTSFRKPKAVVLSFPHNPTTLC 188 YP+++ + GG+ +PIL F L L + + +R+ K + +++P+NPT Sbjct: 130 YPVYHAGTLFAGGETYYMPILESNGF----LPDLSAIPDSVYRRTKIMFINYPNNPTGAV 185 Query: 189 VDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVAVELYSMSKGFS 248 FF EV++ A + G + HD AY+++ FDG P S L GA +V +E +S+SK F+ Sbjct: 186 APDSFFAEVIEKATKYGFIVAHDAAYSEIYFDGNAPKSFLSFPGAKEVGIEFHSLSKTFN 245 Query: 249 MAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTPIQVASIIALESPYEVVEKNREIYRRRR 308 M GWRV F VGN ++ L +KS +D G+F +Q ASI A+ P +E R +Y+ RR Sbjct: 246 MTGWRVGFAVGNASVLAGLGKIKSNMDSGIFQALQEASIAAMALPDFWMENLRSMYQERR 305 Query: 309 DVLVEGLNRVGWEVKKPKGSMFVWAKVPEEVGMNSLDFSLFLLREAKVAVSPGIGFGEYG 368 DVLV GL G V P S ++WA +P GM S + SL LL + +PG GFG G Sbjct: 306 DVLVSGLRTAGLRVIPPGASFYLWAGIP--AGMKSEEASLALLSRTGIVATPGNGFGISG 363 Query: 369 EGYVRFALVENEHRIRQAV 387 EGYVRFAL + R+++A+ Sbjct: 364 EGYVRFALTVDTPRLKEAI 382 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 395 Length adjustment: 31 Effective length of query: 371 Effective length of database: 364 Effective search space: 135044 Effective search space used: 135044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory