Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_014449302.1 LFE_RS05775 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= BRENDA::D2Z0I0 (402 letters) >NCBI__GCF_000284315.1:WP_014449302.1 Length = 399 Score = 417 bits (1072), Expect = e-121 Identities = 206/391 (52%), Positives = 271/391 (69%), Gaps = 5/391 (1%) Query: 7 FPKVKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVANRPNVHG 66 F ++ LP YVF++VN+LK RR GEDI+DLGMGNPD+P I+DKL E A P H Sbjct: 3 FNRINSLPPYVFSIVNDLKTAARRRGEDIIDLGMGNPDLPTPMSIVDKLVEAARNPRNHR 62 Query: 67 YSASKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGDTVIVPN 126 YSASKGIP+LR+AIC Y R YGV LDPE A++TIG+KEG +HL LA +EPGD V+VPN Sbjct: 63 YSASKGIPKLREAICGLYNRHYGVTLDPETEAVVTIGSKEGIAHLALATMEPGDKVLVPN 122 Query: 127 PTYPIHYYAPIICGGDAISVPILPEEDFPEVFLRRLYDLIKTSFRKPKAVVLSFPHNPTT 186 PTYPIH +A + G + + P+ PE D L + I+ + KAV+L +PHNPTT Sbjct: 123 PTYPIHAFAFSLAGAEVLRYPMNPEGDHKADVL----EAIENAGPGLKAVLLCYPHNPTT 178 Query: 187 LCVDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVAVELYSMSKG 246 + V F+ VV+LA + +++HD AYAD+ F GY PS L+V GA +V E +++SK Sbjct: 179 MTVPDGLFERVVELAHERNFFVIHDLAYADITFGGYRAPSFLEVPGAKEVGAEFFTLSKS 238 Query: 247 FSMAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTPIQVASIIALESPYEVVEKNREIYRR 306 ++M GWRV F+VGN+ ++ L LKSYLDYG+F PIQ+ASI AL + + +K +Y + Sbjct: 239 YNMPGWRVGFLVGNKQIVGALTRLKSYLDYGMFQPIQIASIHALNNHDQTPQKISAVYEK 298 Query: 307 RRDVLVEGLNRVGWEVKKPKGSMFVWAKVPE-EVGMNSLDFSLFLLREAKVAVSPGIGFG 365 R VLV+GLNR GW V PKGSMFVWAK+P+ M S++F+ L+ EA+V VSPG+GFG Sbjct: 299 RCKVLVDGLNRAGWSVTMPKGSMFVWAKIPQIHRHMGSVEFAKLLMSEAQVGVSPGVGFG 358 Query: 366 EYGEGYVRFALVENEHRIRQAVRGIKKALDK 396 G+ +VRFALVENE RIRQA I++ L K Sbjct: 359 SAGDDHVRFALVENESRIRQATMNIRRFLVK 389 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 399 Length adjustment: 31 Effective length of query: 371 Effective length of database: 368 Effective search space: 136528 Effective search space used: 136528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory