Align asparagine-oxo-acid transaminase (EC 2.6.1.14); alanine-glyoxylate transaminase (EC 2.6.1.44); serine-glyoxylate transaminase (EC 2.6.1.45) (characterized)
to candidate WP_014449374.1 LFE_RS06190 alanine--glyoxylate aminotransferase family protein
Query= BRENDA::Q56YA5 (401 letters) >NCBI__GCF_000284315.1:WP_014449374.1 Length = 380 Score = 207 bits (528), Expect = 3e-58 Identities = 119/382 (31%), Positives = 212/382 (55%), Gaps = 7/382 (1%) Query: 9 RHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFLFPTT 68 + +L PGP +P V+ AM+R +RSP + + + +D+K +F+T + Sbjct: 3 KQYLLAPGPTPVPPEVLLAMSRPIIHHRSPDFIPVIQDVRKDLKWLFQTEQEV-ITVAGS 61 Query: 69 GTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLAS 128 GT E++++N +SPGD+I++ G+F W ++ +WG+ N+ + + Sbjct: 62 GTAGMEASISNFMSPGDKILAVNGGKFGERWAKIATAFGVTTIEIKVNWGESVNVSEIKA 121 Query: 129 KLSQDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMD 188 L +D + I+ + + +ET+TGV +D+ ++ + ++ +L+VD ++++ + MD Sbjct: 122 HLDKDPS--IRGVYVQASETSTGVAHDVKSIAEITKTREN-TILVVDAITALGVTNLPMD 178 Query: 189 EWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWP 248 WG+D+ +TGSQKAL LP GL + S KA + +K + + D K L Sbjct: 179 LWGIDILITGSQKALMLPPGLACIGVSEKAWKHQSQAKCSRFYLDLKRE-KDNLLKDTNA 237 Query: 249 YTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNTV 308 +TP++ L GL +L ++ EEGLEN+ ARH++L +ATR V+ +GL+ + S+ V Sbjct: 238 WTPAVTLWIGLATSLKMMREEGLENVFARHSKLARATREGVKGFGLEVFAKNAP--SDAV 295 Query: 309 TAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLAGVEM 368 TAV+ P DG + + ++Y ++ G +++ GKVFR+ H+G + ++ ++GVEM Sbjct: 296 TAVLAPEGFDGEALYKNLRKQYGITAAGGQDQLKGKVFRLSHMGYSDTFDIITAISGVEM 355 Query: 369 ILKDVGYPVVMGSGVAAASTYL 390 L +GY +GSGVA A L Sbjct: 356 ALYRMGYKHPLGSGVAKAQAVL 377 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 380 Length adjustment: 31 Effective length of query: 370 Effective length of database: 349 Effective search space: 129130 Effective search space used: 129130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory