Align branched-chain-amino-acid aminotransferase; EC 2.6.1.42 (characterized)
to candidate WP_014448409.1 LFE_RS00950 branched-chain amino acid transaminase
Query= CharProtDB::CH_024500 (309 letters) >NCBI__GCF_000284315.1:WP_014448409.1 Length = 311 Score = 274 bits (700), Expect = 2e-78 Identities = 145/304 (47%), Positives = 198/304 (65%), Gaps = 10/304 (3%) Query: 4 KKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHD 63 K++ +IW +G+MV W+DA VHV++H+LHYG +VFEGIR Y +G +FR EH +RL + Sbjct: 3 KESQWIWMDGKMVPWKDANVHVLTHSLHYGMAVFEGIRAYSGPEGTSIFRLAEHTRRLVN 62 Query: 64 SAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGV----NPPAGYSTD 119 S K+ S +ELM+A V+R+NNL+S YIRPL++VG MG+ NP Sbjct: 63 SGKVMLMKSPYSEEELMDATCRVVRENNLSSCYIRPLMYVGYGDMGIYARQNPIC----- 117 Query: 120 VIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHG 179 V I+A+ WG YLG E L +GI A +SS++R NT AK +Y++S L E + G Sbjct: 118 VSISAWEWGTYLGEEGLSKGIRAKISSFSRFGVNTFLNRAKVSAHYVNSQLAKWEVKMAG 177 Query: 180 YQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVRE 239 Y E I LD +G+++EG GEN+F V GVL TP + L GITR+A+ LAKE+GI V E Sbjct: 178 YDEAILLDQDGFVAEGPGENIFIVSGGVLRTPAL-KTVLDGITRNAVQTLAKEMGIPVWE 236 Query: 240 QVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETED 299 VL+R+ LYLADE F +GTAAE+TP+R +D +G GR GPVT +Q+AFF + G +D Sbjct: 237 GVLTRDDLYLADEAFFTGTAAELTPIREIDERTIGTGRPGPVTLALQKAFFDVVHGHVKD 296 Query: 300 KWGW 303 W Sbjct: 297 HSEW 300 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 311 Length adjustment: 27 Effective length of query: 282 Effective length of database: 284 Effective search space: 80088 Effective search space used: 80088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory